KEGG   Rattus norvegicus (rat): 502525Help
Entry
502525            CDS       T01003                                 

Gene name
Dnajc19, RGD1560220
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C19
  KO
K09539  DnaJ homolog subfamily C member 19
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    502525 (Dnajc19)
   03029 Mitochondrial biogenesis [BR:rno03029]
    502525 (Dnajc19)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   502525 (Dnajc19)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    502525 (Dnajc19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-GeneID: 502525
NCBI-ProteinID: NP_001128112
RGD: 1560220
Ensembl: ENSRNOG00000049819
UniProt: M0R6L8
Position
2q24
AA seq 178 aa AA seqDB search
MASTVVAVGLTIAAAGFAGRYVLQAMKHVEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTK
REAALILGVSPTANKGKIRDAHRRIMLLNHPDKGPLVEEGLKPIPICRSCSSICRRSILS
CSTSYNQNKDCFIHCVCLCAFMNAPMGTPVRHCETHLTHLPQPTSSTGLTCFGLELEL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggccagtacagtggtagcagtcggattgaccattgctgctgcaggatttgcaggccgt
tatgttttacaagccatgaagcatgtggagcctcaagtaaaacaagtttttcagagtcta
ccaaaatctgccttcagtggtgggtactatagaggtgggtttgaacccaaaatgacaaaa
cgggaagcagcattaatactaggtgtaagccctactgccaataaagggaagatcagggat
gctcatcgacggattatgctcttaaaccacccagacaagggccctctggtggaagaaggt
ctgaaacccataccaatctgtcgcagctgttcatcgatctgcaggcgttccattcttagt
tgttccacttcctacaatcaaaacaaagactgttttatacactgtgtgtgtctatgtgca
ttcatgaatgcacctatgggtacacctgtcagacactgtgagacccacttgacccatctt
ccccagcccacatcctctacaggtttgacatgttttggactagagctagaactgtag

DBGET integrated database retrieval system