KEGG   Rattus norvegicus (rat): 502684Help
Entry
502684            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC502684
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4618 Activator-TraM
Motif
Other DBs
NCBI-GeneID: 502684
NCBI-ProteinID: NP_001020231
RGD: 1559448
Ensembl: ENSRNOG00000023721
UniProt: Q5XIK0
Position
3q41
AA seq 274 aa AA seqDB search
MSSGAEKNLKPSTLPPLRQAKGHSKRKTKSVTKIQPVAQSQVSVDMTTATKTPRALRRRD
QPHHGKVQAKVRLMKSMLRNQRTSLQELYSHEGYLSKLNQELIKTILETEDSTALSVREM
LQQQNILGNIIDILEYSNKKRVQELRSEFQEWKEKEESKTNTLQWEVEQLNSEIRKANEE
VNLLSTYMDHEYPIRLVQIANHVRLVQQAKDSQQDELDNLREMREKVLAFFSNIIQEKKR
RILKSLVVKTQEPHENRLLLKTRDSRRLQSLSSS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgggggcagagaagaacttgaagccatccaccctgcctcccctccgacaagcc
aaaggccacagcaaaaggaaaacgaagagtgtcactaaaatccaaccagtagcacagtcc
caggtctctgtagatatgacaaccgcaacgaagactccacgagcactgcgaagacgggac
caaccgcaccacgggaaagtgcaggccaaggtccggctgatgaagtcaatgcttcgaaac
cagcggacctcgctccaggagctctacagccatgaaggctacctcagcaagctcaaccag
gagctgatcaagaccatcttggaaactgaggacagcacggccttgagcgtgcgtgaaatg
ctgcagcagcagaacatcctcgggaatatcatcgacatcttggagtactcaaacaagaag
agggtgcaagagctgaggtctgagttccaggagtggaaagagaaggaggagagcaagaca
aacacacttcagtgggaggtggaacagctgaactctgaaatccggaaggccaatgaggag
gtgaatttacttagcacctacatggaccacgagtatcccatcaggttggttcagattgcc
aaccatgtgcgcctggtgcagcaggcaaaggacagccagcaggacgagctggacaacctt
agggagatgcgtgaaaaagtcctggcatttttttccaacataattcaagagaagaagagg
agaatcctgaagtctctggtggtgaaaacccaggaaccccatgagaacagacttctgctg
aagacccgggacagccggcgcctgcagagcttatcaagcagctga

DBGET integrated database retrieval system