KEGG   Rattus norvegicus (rat): 502755
Entry
502755            CDS       T01003                                 

Gene name
RGD1562066
Definition
(RefSeq) similar to odorant receptor ORZ6
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    502755 (RGD1562066)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    502755 (RGD1562066)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    502755 (RGD1562066)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Baculo_11_kDa
Other DBs
NCBI-GeneID: 502755
NCBI-ProteinID: XP_001071717
RGD: 1562066
Ensembl: ENSRNOG00000050977
UniProt: M0R8E2
Position
4q23
AA seq 314 aa
MMDNLSSATEFCLLGFPGSQELHYILFAIFFFFYSVTLLGNMVIIMIVCVDKRLQSPMYF
FLGNLSLLEILVTTTIVPLMLWGLLLPGKQTISLTGCIAQLFLYLSLGTTEFAVLGAMAV
DRYVAVCNPLRYSVIMNSRTCIWVVMVSWLFGFLSEIWPVYATFQFTFCESNLLDHFYCD
RGQLLQLSCNETLLTEFILFLMAVFIIVGSLIPTIVSYTYIISTILKIPSASGRRKAFST
CASHFTFVVIGYGTCLFLYVKPKQTQAAEYNRVASLLVSVVTPFLNPFIFTLRNDKVKES
LRDGMKRCCLFFRD
NT seq 945 nt   +upstreamnt  +downstreamnt
atgatggacaatctctctagtgcgaccgaattctgccttctgggtttccctggatcccaa
gaactacactacatcctttttgctatattctttttcttctactcagtgacactgctggga
aacatggtcatcatcatgattgtctgtgttgataaacgtctacagtcccccatgtacttc
ttccttggcaacctctctctcctagagatcctggtaacgactacaattgtccccttgatg
ctctgggggctcctcctccctggcaagcagacaatatctctgactggatgtattgcccaa
ctcttcctttacctctctctagggaccacagagttcgcagtacttggagcaatggctgtg
gaccgttatgtggctgtgtgcaatcctttgaggtacagcgtcatcatgaacagccgcact
tgcatttgggtggtgatggtgtcctggttgtttggttttctttcagaaatctggccagtc
tatgccacattccagtttactttctgcgaatcaaatctgttagatcatttctactgcgac
cggggccaattgctccaattatcttgtaatgaaaccttgctcacagagttcattctattc
ttaatggcggttttcattattgttggatccttgatccccacaattgtctcctacacttat
atcatctccaccatcctcaaaatcccctcagcctctggccggaggaaagccttctccacc
tgtgcctcccacttcactttcgttgtcattggctacggcacctgcttgttcctctatgtg
aaacccaagcaaacgcaggcagcagagtacaacagggtggcctcactgctggtttctgtg
gtcactccttttctgaaccccttcatcttcactctccggaatgacaaagtcaaagagtcc
cttagagatggaatgaagcgttgctgtctgttcttcagggattag

DBGET integrated database retrieval system