KEGG   Rattus norvegicus (rat): 502857Help
Entry
502857            CDS       T01003                                 

Gene name
Noto, RGD1562910
Definition
(RefSeq) notochord homeobox
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Homez HTH_23
Motif
Other DBs
NCBI-GeneID: 502857
NCBI-ProteinID: NP_001178943
RGD: 1562910
Ensembl: ENSRNOG00000037863
UniProt: F1M4Z8
Position
4q34
AA seq 245 aa AA seqDB search
MSSPVPQPASSGTQVQPGDLGPCPVAVSPVVPNHLARGRLESSFSVEAILARPETREHSA
TSLPLSTCTSLNFGSVSQYQVLPWVCSTGTWLPTYLSVGIYPMCSMSCMPGLNVTHLFCQ
QGLRLTGSELPSCLGPLKRAPTVNLQDHNTERHQKRVRTMFSEQQLGELEKVFAKQHNLV
GKERAQLAARLHLTENQVRIWFQNRRVKYQKQQKLKSPPPDAMEEPSNSSEGNVRNEDAE
AGVGS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcccagtgccccagcctgcttcctcaggcactcaggtccagcccggggacttg
ggaccctgtccggtggctgtttccccagtagtcccgaaccacctagctcggggacgcctg
gagtcctccttctctgttgaggccatcctggcgagacccgagactcgtgagcactctgcc
acgtctctgccgctctctacctgcaccagtctgaactttggctctgtgtcacagtaccag
gtcctgccctgggtgtgctccacggggacttggctgcccacctacctgagcgtaggcatc
tacccgatgtgctccatgtcctgcatgcccggattgaatgtgactcacctcttctgccaa
cagggcctcagactcacagggtcagagctaccttcctgtctaggccctctgaaacgggca
cccactgtgaaccttcaggaccacaataccgagagacaccaaaagagggttcgcacaatg
tttagcgagcagcagctgggagagttggagaaggtatttgcaaagcagcacaacctggtg
gggaaggagagagcccagttggctgccaggctgcacttgacagagaaccaggtaaggatc
tggttccagaatcgcagggtaaagtatcaaaagcagcaaaaactgaagtcacctccccct
gatgccatggaggagccctccaacagctcagagggcaacgtccggaatgaagacgctgag
gcaggagttggcagttaa

DBGET integrated database retrieval system