KEGG   Rattus norvegicus (rat): 502858Help
Entry
502858            CDS       T01003                                 

Gene name
Gp9
Definition
(RefSeq) glycoprotein IX (platelet)
  KO
K06263  platelet glycoprotein IX
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    502858 (Gp9)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    502858 (Gp9)
   04611 Platelet activation
    502858 (Gp9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    502858 (Gp9)
CD molecules [BR:rno04090]
 Proteins
  502858 (Gp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRRNT LRR_8 LRRCT LRR_4
Motif
Other DBs
NCBI-GeneID: 502858
NCBI-ProteinID: NP_001026995
RGD: 1561601
Ensembl: ENSRNOG00000010015
UniProt: Q4AEG0
Position
4q34
AA seq 189 aa AA seqDB search
MAPAQASQPICWIPTWGLLLLLWPVTTATQDCPRPCTCQSLETMGLKVNCEGRGLTALPV
LPANTRQLLLTNNSLRSVPPGAFDHMPQLWELKVAHNPWHCDCSLTYLRLWLEDHMPEAL
SHVYCASPDLATQRPLGQLTGYELGNCGWKLPPSWAYSGIWWDVSLVAVAVLGLILLAGL
LNTFTESRN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagcccaggcctcacagcccatctgctggatacctacctgggggctcctgttg
ctgctctggcctgtgaccacagctactcaggattgccccagaccctgtacctgccagtcc
ttggaaaccatggggttaaaggtaaactgtgaggggcgaggcctcacagccctgcctgtg
ctgccagctaacactcgccagctcctgctgaccaacaacagcctacgttcagtgccaccg
ggtgcctttgaccacatgcctcagctgtgggaacttaaggtggcacacaacccctggcac
tgcgactgcagcctcacctacctacgcctctggctggaggaccacatgcccgaggccctg
tcacatgtgtactgtgccagcccggacttggctacccagcgcccactgggccagctcaca
ggctatgagctaggtaactgtggctggaagctgccaccatcctgggcctattcagggatc
tggtgggatgtgtcactggtggctgtggctgtgctaggcctgattctgctggctggtcta
ctgaacacatttacagagtcccggaactga

DBGET integrated database retrieval system