KEGG   Rattus norvegicus (rat): 502875
Entry
502875            CDS       T01003                                 

Gene name
H1foo, RGD1566236
Definition
(RefSeq) H1 histone family, member O, oocyte-specific
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Linker_histone TrmB
Other DBs
NCBI-GeneID: 502875
NCBI-ProteinID: NP_001102821
RGD: 1566236
Ensembl: ENSRNOG00000025251
UniProt: D3ZEG0
Position
4q42
AA seq 332 aa
MAPGSVSSVSSSSSVPSSDTSPPGSCGLPGAVSPDPSCSRIQVGQRNPTMLRMVLEALKA
REKRQGTSVVAIKVYIQHKYPTVGTTRFKYLLKQALETGMRRGLLTRPANSKAKGATGSF
KLVPKPKKKRTCAPKARGGATGTKETGSKESGLRKKDQVGKAKTEKAAPNPGRKRKAYPC
SAATLEKAPKNAKAVPREVREAPLKRDKAAGAPLTANIGQKVKHSGTGQEADAHGKTKDV
CEKSKASASKVQNSVASLIKKEMAAIAHMETVVQGAKTVQKTKAPTPSQDVRHKAQPTTR
VRKTKTPEDTKRPQLPPKTSSKAPSKKAEASS
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctccagggagtgtctccagtgtttcttcctcctcctctgttccctccagcgacaca
tcacctcctggatcatgtgggctccctggggctgtcagtccagatccaagttgcagcagg
atccaagtaggccagcggaacccgacaatgctgcgtatggtactagaggctctgaaggcc
agggagaagcgccagggcacctcagttgtagccatcaaggtctatatccagcataagtac
cccacagtgggcaccacccgcttcaagtacctgctgaagcaggccctggaaactggcatg
cggcgaggcctcctcaccaggcctgccaactccaaggccaagggtgccactggcagcttc
aagctagttcccaagcccaagaaaaagagaacctgtgccccgaaagcccgtgggggagct
acaggtaccaaggagacaggctccaaggaatccggattgcggaagaaagaccaagttggc
aaggccaagacggagaaagcggctccaaacccagggcggaagcggaaggcttatccctgt
tcagcagccacgttggagaaggcgcctaagaatgccaaggcggtgccaagagaggtccga
gaggcccccctaaaacgagacaaagctgcaggggcccctctcactgccaacataggccag
aaggtcaaacacagtgggaccgggcaagaagcagatgcccatgggaagaccaaagatgtg
tgtgagaaatcaaaggcctcggctagcaaggtccagaatagtgttgcttccctcatcaaa
aaggagatggcagccatagcccacatggagacagttgttcagggggctaagacggtgcag
aagaccaaagcgcccactccttcccaggacgtcagacacaaggcacagcccacaactagg
gtcaggaagacaaagacccccgaggacaccaaaaggcctcagttaccccccaagacctca
tccaaggctcccagcaagaaggctgaggctagtagctag

DBGET integrated database retrieval system