KEGG   Rattus norvegicus (rat): 502886
Entry
502886            CDS       T01003                                 

Gene name
Foxj2, RGD1565101
Definition
(RefSeq) forkhead box J2
  KO
K09403  forkhead box protein J2/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    502886 (Foxj2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    502886 (Foxj2)
SSDB
Motif
Pfam: Forkhead Presenilin Spt20
Other DBs
NCBI-GeneID: 502886
NCBI-ProteinID: NP_001102822
RGD: 1565101
Ensembl: ENSRNOG00000009000
UniProt: D3Z992
Position
4q42
AA seq 583 aa
MASDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGGTRKCSPGSPTDPNATLSKDEAS
VHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSL
NKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVPGS
GEASLSHEGNPQMSLQSPSSMASYSQGPGPVDGGAVAAGAPGQESTEGAPPLYNTNHDFK
FSYSEINFQDLSWSFRNLYKSMLERSSSSQHGFSSLLGDMPPSNNYYMYQQQQQQQQQQQ
QQQQQQQQQQQQQQPPPQPQPPPQQPQPQQQQAPTQGPSNVGGAPPLHTPSPDGCTTPGG
KQAGAEVYGPPTGMAMHPPPLQHGGYHPHQHHPHSHPAQQPPQQQAQSQAPINSTGFAFP
PDWCSNIDSLKESFKMVNRLNWSSIEQSQFSELMESLRQAEQRNWTLDQHHIANLCDSLN
HFLTQTGHMPPQGGSHRPPAPSRITDSCALTSGKPEPSMNQVNSYGHPQASHLYPGPAPM
YPISTQDSAGYSRPTHHMVPRPPVPPPGANEEITDDFDWDLIT
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcctccgacctggagagtagcctcacctccatagactggctgccacagctgactctc
agagccactattgagaagcttgggagtgcttctcaggctgggcctccagggggcacccgg
aagtgctcgccaggctccccgacagatccaaacgccaccctcagcaaagatgaggcatca
gtccaccaagatggcaagccgcggtacagctatgccaccctcatcacctacgccatcaat
tcctctccagctaagaagatgactctcagtgagatttaccgctggatctgcgacaacttc
ccctattacaagaacgccggcatcggctggaagaattccattcgacacaacctttccctt
aacaagtgtttccggaaggtgcccagacctcgggatgatcctgggaagggctcctattgg
acaattgacacctgccctgacatttcccggaagagaagacaccctccagatgatgaccta
tcccaagactccccagagcaggaggccagcaagagcccccggggaggtgttccagggagt
ggagaagcctcactctctcatgagggcaatcctcagatgtcactgcagagcccctcctcc
atggccagctacagccagggcccagggcctgtggatggtggagcagtggcagcaggggcc
ccaggccaggagagcacagagggtgcccctcccctctacaacaccaaccatgacttcaaa
ttctcctactccgagatcaactttcaggacctaagctggtccttccgaaacctctacaag
tccatgctggagcggtcctcctcctcccagcacggcttttcctcactccttggagacatg
ccaccttccaacaactattacatgtaccagcagcagcagcagcagcagcagcagcagcag
cagcagcagcagcagcagcagcagcagcagcaacagcagcagccaccgccgcagcctcag
cccccaccccagcaaccacaaccgcagcagcagcaggcacccactcagggcccctcaaat
gtagggggtgcccctccactgcacaccccaagccccgatggctgtactacaccaggggga
aaacaggcaggagctgaagtctacggcccccccactgggatggccatgcaccctccccca
ctgcagcatggaggctaccaccctcatcagcaccatccccactcccaccctgcccagcag
ccaccacagcagcaggcacagagccaggcacccatcaacagcaccggctttgcctttcct
ccagactggtgctccaatattgactccttaaaggaaagcttcaaaatggtgaaccggctc
aactggtccagcatcgagcaatcccagttctcagagctgatggagagcctacggcaggca
gagcagaggaactggaccctcgatcagcatcacatcgccaacttgtgtgactccctcaac
cacttcctcacccagactggtcacatgcccccgcaagggggctcccaccgaccacctgcc
ccttcccggatcactgactcctgtgctctcaccagtggcaaaccggagccatctatgaac
caagtgaactcttatgggcacccgcaagcctctcatctctaccctggcccagcaccaatg
tacccaatctccacccaagactcagcaggatacagtcgcccaacacaccacatggttccc
cggccacctgtcccacctcctggtgccaatgaggagatcactgatgacttcgactgggac
ttgatcacttaa

DBGET integrated database retrieval system