KEGG   Rattus norvegicus (rat): 502891Help
Entry
502891            CDS       T01003                                 

Gene name
Vom2r51, RGD1561712
Definition
(RefSeq) vomeronasal 2 receptor, 51
  KO
K04613  vomeronasal 2 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    502891 (Vom2r51)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    502891 (Vom2r51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 ANF_receptor NCD3G
Motif
Other DBs
NCBI-GeneID: 502891
NCBI-ProteinID: NP_001092980
RGD: 1561712
Ensembl: ENSRNOG00000037155
UniProt: D3ZHA4
Position
4q42
AA seq 854 aa AA seqDB search
MKLLIAFSLLIVLIVFQEQISWFSLSIPASPGYYQDGDFVIGGLFSLRVTAGDTKSKFGF
KDTISMPDIVYADFTKHYQHMLAMVFAIENINKDPNILFNMSLGFYLFNVDFIEMKAVES
SMALLSGETPPVPNYSCRPEKTDKLVAVIGGISTGISTQISRVLSLYNVPQISYAPFDQS
LGTEVQLQSPYQFPVHTTALYQGIIQLLLYFTWIWVGLVVPDDVRGELFLRDITEEMNNH
GLCVAFAEKVPEFPARDTINRKLFMERFILTRVIVAFGDTYSLLRFVYNIYCNTPFGNIW
ITTSDWDITTLPFQQNLGYTYFGGGLSFSVHTDEILEFKDFLRSVQPRKYPQDIFIQDVW
SNLFECPYLDKDWIRELSQCEQNGNLSTRPLYLWDMNTSPSSYKVHFAVYAIAEALHEEL
SLTVEGDSLRKGGPRALLPWKLHPFLQKCQLGRSSNEQNVMNNEVSATKLDIFNYQSLQS
GTKAQVKVGKFVYESHSVQHFSLNDKIIMWGEHHNHTPFSVCSQSCPLGFRKSPIEGKPF
CCFDCLPCPDGEIANETDMDQCIKCPEDQYPNKQRNWCHPKITAFLSHEDTLGAVLVSVA
ISLSVFSAMILGLFICYRDTPIVRANNRNLSYLLLVSLMLCFFCSLIFIGQPRTVTCVLR
QTIFGVVFSIAISAILAKTFIVVVAFKAIKPGSTLQTWMVTRVSNAIVCCGSIIQVCICA
VWLGTYPPFPDVDMHSEFGQIILWCNEGSTLAFYCVLGYLGFLASLSLLIAFLARRLPDT
FNEAKTITFSMLVFCSVWISFVPAYLSSKGKTMVAVEILTILASSAGLLGCIFLPKCFVI
LLKSGGLPRKKFSI
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgctcattgctttctctctcctgattgttctcattgtattccaggaacaaatt
tcttggttttccttaagtatacctgcctctcctggctactatcaagatggggattttgtt
attggaggactcttttcccttagagtgactgctggagacactaaaagtaaatttggcttt
aaagatacaatctctatgcctgatattgtttatgcggatttcaccaaacattatcagcac
atgttggcaatggtttttgctatagaaaatatcaacaaggatccaaatattttattcaat
atgtccctgggattctatctcttcaatgttgactttattgagatgaaggctgtggagagt
tctatggctttgctctcaggagagacccccccagttcctaactacagctgcaggcctgag
aagactgataagctggttgcagtgataggaggcatttcaacaggaatatcaacccagatc
tcccgagttctaagtctctacaatgtccctcagatcagctatgctccttttgaccagagt
cttgggaccgaagtccagctccagtctccttaccagtttcctgtgcataccacagctctg
tatcagggaattattcaactgctgctatacttcacttggatctgggttggcctggtggtt
ccagatgatgtgaggggagaactcttccttagggacatcacagaggagatgaacaaccat
ggactttgtgttgcatttgcagaaaaggttccagaattccctgctagggacacaataaac
aggaaactttttatggaaagattcatattgacccgtgttattgttgcatttggtgacaca
tattctcttctgagatttgtctacaacatctattgtaataccccttttggtaacatctgg
atcacaacttctgattgggatatcaccacattaccctttcaacaaaatctaggttatacc
tattttggtggaggattatcattttctgttcacacggatgaaattctggaattcaaggat
tttctcagaagtgttcaacctaggaaataccctcaagatatctttatccaggatgtgtgg
tcgaacttatttgaatgtccttatttagataaggactggatcagggaactgagtcaatgc
gagcaaaatggcaacctcagcacccgacctttatatctttgggacatgaatacttcaccc
tcaagctacaaagtccattttgctgtatatgccattgccgaggcccttcatgaggagctg
tcactcaccgtggaaggagactcactcaggaaaggtggtccccgagctcttctcccatgg
aagctccatccattcttacaaaagtgccaacttgggagaagctccaatgagcagaatgtc
atgaacaatgaggtttcggcaaccaagcttgacatctttaattaccagtctctgcagagt
ggtaccaaagctcaagtgaaagttggcaagtttgtatatgaatctcacagtgttcaacat
ttttccctaaatgacaaaatcataatgtggggtgaacaccacaatcatacgcctttttct
gtttgcagtcaaagttgtccacttggatttaggaaatcacctattgaagggaaaccattc
tgttgttttgattgtcttccatgtccagatggagagattgcaaatgaaacagatatggat
caatgcatcaagtgtcctgaagatcaatatcccaataagcagaggaattggtgtcacccc
aaaattacagcatttttgtcccatgaagatactctaggagcagttttggtttccgtggca
attagtttatctgtcttttcagccatgattttaggattatttatctgctatcgggacaca
cccattgtcagagcaaataacagaaatctcagttatctcctcctggtttctctaatgctc
tgcttcttttgctcattaatattcattggccaacctagaacagtcacttgtgtcttgaga
caaacaatttttggggttgtattttccattgccatttctgctatcttggcaaagaccttc
attgtggttgtggccttcaaggccatcaaacctggaagcactttacaaacatggatggtg
acccgagtctcaaatgctatagtctgctgtggttccatcattcaagtgtgcatctgcgcc
gtctggctgggaacgtatccccctttccctgatgtcgacatgcactcagagtttgggcaa
atcatcctctggtgtaatgagggctccacccttgccttctattgtgttctggggtacttg
ggctttctggccagtctcagcttgcttattgcttttcttgctagaaggctaccagacacc
ttcaatgaggcaaaaacaatcacattcagcatgctggttttctgcagtgtgtggatttct
tttgtacctgcttacctgagctccaaaggcaaaaccatggttgctgtggaaattctcaca
attctggcttccagtgctggcttactgggctgtatatttcttcccaaatgctttgtgatc
ctactgaaatcaggtggccttccaagaaagaagttctctatatga

DBGET integrated database retrieval system