KEGG   Rattus norvegicus (rat): 502902
Entry
502902            CDS       T01003                                 

Gene name
Clec7a, Clec7b, RGD1565140
Definition
(RefSeq) C-type lectin domain family 7, member A
  KO
K10074  C-type lectin domain family 7 member A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    502902 (Clec7a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    502902 (Clec7a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    502902 (Clec7a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    502902 (Clec7a)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    502902 (Clec7a)
   04090 CD molecules [BR:rno04090]
    502902 (Clec7a)
   04091 Lectins [BR:rno04091]
    502902 (Clec7a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    502902 (Clec7a)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   502902 (Clec7a)
CD molecules [BR:rno04090]
 Proteins
  502902 (Clec7a)
Lectins [BR:rno04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   502902 (Clec7a)
SSDB
Motif
Pfam: Lectin_C Ly49 UL45
Other DBs
NCBI-GeneID: 502902
NCBI-ProteinID: NP_001166857
RGD: 1565140
Ensembl: ENSRNOG00000054251
UniProt: B5BUZ1 B2RYG9
Position
4q42
AA seq 235 aa
MDEDGYTQLDFGTRNIHKRPVKSEKGSPAPSSRWRSIAVALGILCLLTVVVAAVLGALAF
RRFNSGRYPEEKDNFPSRNKENHKPTEPSLDEKVAPSKASQTTGVFSGPCLPNWIMHAKS
CYLFSFSENSWYGSRRHCSQLGAHLLKIDNAKEFEFIESQTSSHRVNSFWIGLSRNQSEG
PWFWEDGSAFTPNSFQVRNTAPQESLPHNCVWIHGSEVYNQMCIASSFTICEKEL
NT seq 708 nt   +upstreamnt  +downstreamnt
atggacgaagatggatatactcaattagacttcggcactcgaaacatccacaaaagacct
gtaaaatcagagaaaggaagcccagctccatcttctcgttggcggtccattgcggtagct
ttaggaatcctgtgcttgctcacagtagtggtcgcagcagtgctgggtgccctagcattt
cggagattcaattcagggagatatccagaggagaaagacaacttcccatcaagaaataag
gagaaccacaaacccacagaaccatctttagatgagaaggtggctccctccaaggcatcc
caaactacaggcgtcttttctggaccttgccttcccaattggatcatgcatgccaagagc
tgttatctatttagcttctcagaaaattcctggtatggaagtaggagacactgttcccag
ctaggagctcatctattgaagatagacaatgcaaaagaatttgagttcattgaaagccaa
acatcttctcaccgtgttaactcattctggataggtctatctcgcaatcagagtgaaggg
ccgtggttctgggaggatggatcagcatttacccccaactcgtttcaagtcagaaataca
gctccccaagaaagcttaccccacaattgtgtttggatccatgggtcagaggtctacaac
caaatgtgcattgcttcctcattcactatctgtgagaaggaactgtaa

DBGET integrated database retrieval system