KEGG   Rattus norvegicus (rat): 502907Help
Entry
502907            CDS       T01003                                 

Definition
(RefSeq) similar to immunoreceptor Ly49si1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ly49 Lectin_C
Motif
Other DBs
NCBI-GeneID: 502907
NCBI-ProteinID: XP_017448545
RGD: 1584856
Ensembl: ENSRNOG00000053661
UniProt: D3ZG59
Position
4q42
AA seq 268 aa AA seqDB search
MSEQEVSYSNVRFQKCSGLQNQVRPEETQRARAAGHRERSVPWQIAVVALVILCSLRLVA
VAMFVTKIFQYTHEKRELPEETLSLINNFSTMQSNIYLKEEMLRNMSINCSQGNDLLQSL
NREQTRWYSETKTVLPSSQHTGQNFEIYWFCYGIKCYYFILDTKAWNGCKQTCQDSSFFL
LKIDDEDELKFLRLQVLSYQYWIGLSYNKTEKEWSWIDNGQSELSLNLKKYNVKDGDCMF
LSKTRLENAMCSSPYPCICQKRLDKFPH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaggaggtgtcttactcaaatgtgagatttcaaaaatgttcaggtttgcag
aaccaagtgaggcctgaggagactcaaagggccagagcagctggccacagagagagatca
gtcccctggcagatcgctgtggtagctcttgtaatcctctgttcccttcggctggtagct
gttgcaatgttcgtgacaaagatttttcagtatactcatgaaaaacgtgaactgccggag
gaaactctaagccttatcaataacttcagcaccatgcaaagtaacatctatttaaaggaa
gaaatgctaagaaatatgtctataaactgtagtcaaggcaatgatctcctgcaatctcta
aacagagaacagacaagatggtacagtgaaactaagactgttttaccttcctctcagcac
acaggccaaaattttgaaatatactggttctgctatggtataaaatgttattatttcatc
ctggacacaaaagcatggaatggatgtaaacaaacctgccaggattccagctttttcctt
ctgaagatagatgatgaggatgaactgaagttccttcggctccaggttctttcataccag
tactggattggattgtcatataataaaacagaaaaggaatggtcatggattgacaatggc
caatctgaattatccttgaacctaaagaaatacaatgtaaaggatggagactgtatgttc
ttgtctaaaacaagactagaaaatgctatgtgctccagcccctacccatgtatttgtcag
aagagactggataagttccctcattga

DBGET integrated database retrieval system