KEGG   Rattus norvegicus (rat): 502913
Entry
502913            CDS       T01003                                 

Gene name
Hist2h4a, RGD1565073
Definition
(RefSeq) histone cluster 2, H4
  KO
K11254  histone H4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    502913 (Hist2h4a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    502913 (Hist2h4a)
  09165 Substance dependence
   05034 Alcoholism
    502913 (Hist2h4a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    502913 (Hist2h4a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    502913 (Hist2h4a)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 502913
NCBI-ProteinID: XP_578415
RGD: 1565073
UniProt: P62804
Position
4q43
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggacgagggaaaggcggcaaaggtctgggtaaaggtggcgccaagcgacaccgc
aaggttctccgagataacatccagggcattaccaagcccgctatccggcgtttggctcgg
cgcggcggtgtcaagcgtatctcaggtcttatctacgaggagactcgcggcgtcctgaag
gttttccttgaaaatgtgattcgcgatgctgtcacctacaccgagcacgccaagcgcaag
acggtcacggctatggacgtggtgtacgcgctcaagcgccagggccgcacgctctatggc
ttcggcggctga

DBGET integrated database retrieval system