KEGG   Rattus norvegicus (rat): 502946
Entry
502946            CDS       T01003                                 

Gene name
Arid3c, RGD1560943
Definition
(RefSeq) AT-rich interaction domain 3C
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: ARID
Other DBs
NCBI-GeneID: 502946
NCBI-ProteinID: NP_001167452
RGD: 1560943
Ensembl: ENSRNOG00000013416
UniProt: D3ZQB1
Position
5q22
AA seq 410 aa
MEALQRQQAARLAQGVGPLAPPRLPLPQPPLLGARTLQAPEGALGVVGAEEEEGAEEDEE
GETPLVEEETAEQSHPGARCPNSPSGQSPGIQPHEWTYEEQFKQLYELDADPKRKEFLDD
LFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTI
TSAAFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTTVPLFNLAGPTP
RGAPGPASSHGPAPTTTPNCPGSTQGSASGLPAHACAQLSPSPVKKEESGIPPPRLAIPV
GLALEAAREKLAPEEPPEKRAVLMGPMDPPRLGATPSFLPRGKAPLREERLDGPLNLAGS
GISSINMALEINGVVYTGILFARRQPVPASLGPTNPPPPPSTGPPSSTLP
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggaggccctgcagaggcagcaggcagcacggctggcccaaggggtggggcccttggcc
cctccacgcctaccgcttccacagcctcctctgcttggcgcccggaccctacaggctcct
gagggggccttaggggtggttggggctgaagaagaggagggtgctgaagaagatgaggag
ggagagacacccttagtggaagaggagacagctgagcagagccatccgggagcccgatgt
cccaattcaccatccggccagtcccctggaatccagccacatgagtggacctatgaggaa
cagttcaagcagctgtatgaactcgacgcggaccccaagaggaaggaatttctggatgac
ctgtttagcttcatgcagaagagggggacgccagtgaaccgggtgcccatcatggccaaa
caggtcctggatctgtatgcgttgtttcgcttggtgacagccaagggaggcctggtggaa
gtcatcaaccgaaaagtgtggcgggaagtcacacgcggcctcagtttgcccaccaccatc
acctctgccgccttcacactacgtacccagtacatgaagtatttgtacccatacgagtgc
gagacgcgggcactcagttctccaggggagctccaggctgccatagacagcaaccggcgt
gagggacgtcgccaggcctacaccacggtcccgctcttcaacttagcaggacccacacct
cggggcgctcctggtcccgcctcgagtcatggccccgccccgaccacgaccccgaattgc
cccggttccacccagggttctgcttctggcttaccagcgcatgcttgtgctcaactgagc
cccagcccagtaaagaaagaggagagtggaatcccaccccctcgtctggcgatacctgtg
ggcttggccttggaggctgcacgggagaagctggcaccagaagagcctccagagaagagg
gctgtgctgatgggccccatggatccacctcgattgggagcaacccccagtttcctgccc
cgtggcaaggctcccctaagggaagagcggttggatgggcccctcaatctggcaggcagt
ggcatcagcagtatcaacatggcgctagagatcaatggggttgtctacactggtatcctc
tttgcccgacgccagcctgtgccagcttccttgggtccgaccaatcctccacccccaccc
tctacagggcccccttccagcaccttaccctga

DBGET integrated database retrieval system