KEGG   Rattus norvegicus (rat): 502988Help
Entry
502988            CDS       T01003                                 

Gene name
Sesn2, RGD1566319
Definition
(RefSeq) sestrin 2
  KO
K20394  sestrin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
rno04150  mTOR signaling pathway
rno04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    502988 (Sesn2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    502988 (Sesn2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    502988 (Sesn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PA26 CMD
Motif
Other DBs
NCBI-GeneID: 502988
NCBI-ProteinID: NP_001102828
RGD: 1566319
Ensembl: ENSRNOG00000042785
UniProt: B2GUV6
Position
5q36
AA seq 480 aa AA seqDB search
MIVADSECHGEIKGYLPFTRGGVAGPGTREEHREGQARRGPRGPSAFIPVEEILREGAES
LEQHLGLEALMSSGRVDNLAVVMGLHPDYLSSFWRLHYLLLHTDGPLASSWRHYIAIMAA
ARHQCSYLVGSHMTEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQA
LLKTGEHSWSLAELIQALVLLTHCHCLASFVFGCGILPEGDAEGSPASQAPSPPSEQGGP
PSRDPLNNSGGFEAARDIEALMERMRQLQESLLRDEGASQEEMENRFELEKTESLLVTPS
ADILEPSPHPDILCFVEDPTFGYEDFTRRGTQAPPTFRAQDYTWEDHGYSLIQRLYPEGG
QLLDEKFQVAYSLTYNTIAMHSGVDTSMLRRAVWNYIHCVFGIRYDDYDYGEVNQLLERN
LKIYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagccgactccgagtgccatggggagatcaagggctacctgccgttcaccagg
ggcggtgtggccggccccgggacccgagaggagcatcgggagggccaggcgcggcgaggc
cctcgaggacccagcgccttcatcccagtggaggagatccttcgggaaggagctgagagc
ctggagcagcacctggggctcgaggctctgatgtcttcagggcgggtggacaacctggcg
gtggtgatgggcctacaccccgactaccttagcagcttctggcgcctccactacctgctg
ctgcacacggatgggcccctggccagctcctggcgccactacattgccatcatggctgct
gcccgccaccagtgttcttacctggtgggttcccacatgaccgagttcctgcagaccggc
ggtgaccccgagtggctgctgggcctccatcgcgcccctgaaaagctccgcaagctcagc
gagatcaacaaattactggcacatcggccatggcttatcaccaaggagcatattcaggcc
ttgctgaagactggagagcacagctggtccctggctgagctcatccaagcgctggtcctg
ctcacccactgccactgtctggcctcctttgtgtttggctgtgggatacttcctgaggga
gacgctgagggcagccctgcctcacaggcaccttcgccacccagtgagcaaggcggcccc
ccaagcagagacccattgaacaactcggggggctttgaagccgcccgtgacatagaagct
ctgatggaacgcatgaggcagcttcaggagagcctcctgcgggatgagggggcttcccag
gaggaaatggagaaccgttttgagctggagaagacggaaagcctgctggtgaccccctca
gcggatattctggagccctctccacacccagacatcctatgctttgtagaggaccccacg
tttggatatgaagacttcactcgtcgagggactcaggcccccccaacctttcgtgcccag
gattatacctgggaagaccatggctactcgctgatccagcggctctaccccgagggaggg
cagctgctggatgagaagtttcaggtagcctacagcctcacctataacaccatcgccatg
cacagtggcgtagacacctccatgctccgcagagccgtctggaactacatccactgcgtc
tttggtatcagatatgatgactatgattatggagaggtaaaccagctcctggaaaggaac
ctcaagatctatatcaagacggttgcctgctacccggagaagacgacccgcagaatgtac
aacctcttttggaggcacttccgccactcagagaaggttcacgtgaacttgctgctcctc
gaagcccgcatgcaagcagctttgctctatgccctccgcgccatcacccgctacatgacc
tga

DBGET integrated database retrieval system