KEGG   Rattus norvegicus (rat): 503052
Entry
503052            CDS       T01003                                 

Gene name
Vash1, RGD1564082
Definition
(RefSeq) vasohibin 1
  KO
K23355  tubulinyl-Tyr carboxypeptidase [EC:3.4.17.17]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    503052 (Vash1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.17  tubulinyl-Tyr carboxypeptidase
     503052 (Vash1)
SSDB
Motif
Pfam: Vasohibin Shadoo
Other DBs
NCBI-GeneID: 503052
NCBI-ProteinID: XP_001058397
RGD: 1564082
Ensembl: ENSRNOG00000010457
UniProt: D4AE85
Position
6q31
AA seq 380 aa
MPGGKKVVPSGSSGASLNAATAATTAAAAAATAAAAAAAHSGITCLETTEGASAQRDEEP
EEEGDEDLRDGGVPFFINRGGLPVDEATWERMWKHVAKIHPDGEKVALRIRGATDLPKIP
IPSVPTFQPTTPIPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEAL
PIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFGGRYGALGMSRRED
LMYKPPAFRTLSELVLDYEAAYGRCWHVLKKVKLGQCVSHDPHSVEQIEWKHSVLDVERL
GREDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSG
EKKPAEPKAMPDLSGYQIRV
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgccagggggaaagaaggtggtcccaagtggcagcagcggtgcctccctgaacgcagcc
acagccgccaccaccgctgctgctgccgccgccactgctgctgctgctgccgctgcccac
tctggcattacatgtttggagaccaccgaaggggcctctgcacagagagacgaggagccc
gaagaggaaggggacgaggacctacgagatggaggtgtcccttttttcatcaaccgaggt
ggactgccagtggacgaggccacctgggaaaggatgtggaagcatgtggccaagatccac
ccagatggagagaaggtggccctgcggatccgtggggctaccgacctgcccaagattccc
ataccaagtgtgcctactttccagccgacaacgcccatccctgagcgcctggaagccgtg
cagcgctacatcagggagctgcagtacaatcacacagggacacagttctttgaaattaag
aagagcagacctctgacagggctgatggatctggccaaggaaatgaccaaagaggctctg
ccaatcaaatgcctggaagctgtgatcctgggaatttacctcaccaacagcatgcccacc
ctggaacgcttccccatcagcttcaagacctatttctcagggaactacttccgccacatt
gtgctgggggtgaactttgggggccgctacggagccctgggcatgagccgaagagaggac
ctgatgtacaaaccgccagccttccgcacgctcagtgagctcgtgctggactatgaggcg
gcctatggccgctgctggcatgtgctgaagaaggtaaagctgggccagtgtgtatcccac
gacccccacagtgtggaacagattgaatggaagcactcagtgctggatgtggagcggctg
gggcgggaagacttccgcaaggagctggagcgtcatgctcgagacatgcgtctcaagatt
ggcaaggggacaggccctccctctcccaccaaggaccggaagaaggatgtttcctcccca
cagagggcccagtccagccctcatcgcaggaacagccgcagtgagagacggccttcaggg
gagaagaagcctgcagagcccaaagccatgccagacctcagtggataccagatccgggtg
tga

DBGET integrated database retrieval system