KEGG   Rattus norvegicus (rat): 503122
Entry
503122            CDS       T01003                                 

Gene name
Cyp4f40, RGD1559596
Definition
(RefSeq) cytochrome P450, family 4, subfamily f, polypeptide 40
  KO
K00490  cytochrome P450 family 4 subfamily F [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    503122 (Cyp4f40)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     503122 (Cyp4f40)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP4 family
   503122 (Cyp4f40)
SSDB
Motif
Pfam: p450 TetR_C_28
Other DBs
NCBI-GeneID: 503122
NCBI-ProteinID: NP_001102830
RGD: 1559596
Ensembl: ENSRNOG00000043344
UniProt: D3ZTC9
Position
7q11
AA seq 523 aa
MRHLDLSWLGLGPMSASPWLLLSLVGVSWFLTRCLTQIYTLYAKCQRLCGFPQPPKRSWF
WGHLGMSPPTEEGMKQMTELVATYPQGFMTWLGPIVPLITLCHPDIIRSVLSASAAVAPK
DGIFYSFLKPWLGDGLLVSASDKWSRHRSMLTPAFHFNILKPYVKIFNDSTNIMHAKWLR
LASGGSAHLDMFENISLMTLDTLQKCVFSFNSNCQEKPSEYIAAILELSALVVKRNEQLL
LHMDLLYRLTPDGRRFYKACHLVHDFTYAVIQERRRTLPKHGGDDVIKAKAKSKTLDFID
VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHPEYQERCRQEVQE
LLRDRDSEEIEWDDLAQLPFLTMCIKESLRLHPPVTMVSRCCTQDISLPDGRVIPKGIIC
IINIFATHHNPTVWQDPEVYDPFRFDPENIQARSPLAFIPFSAGPRNCIGQTFAMNEMKV
AVALTLLRFRVLPDDKEPRRKPELILRAEDGLWLRVEPLSAQA
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgcgacatctggacctatcctggctgggactggggcccatgtcagcctctccatggctg
ctcctttccttggttggtgtttcctggttcttgacccgctgcctcacccagatatacact
ttgtatgcaaagtgtcaacgtctctgtggtttccctcagccacccaagaggagttggttt
tggggtcacctaggcatgtcccctcctacagaagaaggcatgaagcagatgactgagctg
gtggccacctacccccagggcttcatgacctggttaggccctatagttcccctcatcact
ttgtgccaccctgacatcatccgatctgtcctcagtgcctcagctgcggttgctcccaag
gatggcatcttctacagcttcctgaaaccctggctgggggatgggctcttggtgagtgcc
agtgacaagtggagccgccaccgtagcatgctgacacctgccttccacttcaacatcctg
aaaccctatgtgaagattttcaatgacagcaccaacatcatgcatgccaagtggctgcgc
ctggcctcagggggtagcgcccatctggacatgtttgagaacatcagcctcatgaccttg
gatactttgcagaaatgtgtcttcagcttcaacagcaactgtcaggagaagcccagtgag
tacattgccgccatcttagaactcagtgcactggtcgtgaaaagaaacgaacagctgctt
ctgcacatggacctgctctaccgcctcacacctgatggaaggcgcttctacaaggcctgc
cacctggtgcatgacttcacctatgccgtcatccaggagcgacgtcgcactctgcccaag
catggtggtgatgatgtcatcaaggccaaagccaagtccaagactctggacttcattgat
gtactgctactgagcaaggatgaagacggaaaggagctgtcagatgaggacatccgagcg
gaggctgacaccttcatgtttgagggccacgacaccacagccagtgggctctcctggatc
ctgtacaacctggcgaagcacccagaataccaggagcgctgccggcaggaggtgcaggaa
ctcctgagggatcgtgattctgaagagattgaatgggacgacctggcccagctgcccttc
ctgaccatgtgcatcaaggagagtctgcgactgcatcccccagtcacaatggtctcccga
tgctgcacacaggacatttctctgccagacggccgtgtcattcctaaaggtatcatctgc
atcatcaatatttttgcaacccatcacaacccaactgtgtggcaggaccctgaggtctat
gaccccttccgttttgatccagagaacatccaggctagatcgcctctggcatttattccc
ttctcggcaggacccaggaactgcataggacagactttcgctatgaacgagatgaaggtg
gcagtggcgctgacgctgctgcgcttccgcgtcctgcccgatgacaaggagccgcgccgg
aagccggagctgattctgcgcgcggaggacgggctgtggctgcgggtggagcctctgagc
gcccaagcatag

DBGET integrated database retrieval system