KEGG   Rattus norvegicus (rat): 503208
Entry
503208            CDS       T01003                                 

Gene name
Bola2-ps1
Definition
(RefSeq) bolA-like protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: BolA
Other DBs
NCBI-GeneID: 503208
NCBI-ProteinID: XP_038938310
RGD: 1563585
Ensembl: ENSRNOG00000015333
Position
8
AA seq 86 aa
MELSADYLREKLRQDLEAEHVEVEDTTLNRCVTSFRVLVVSAKFEGKPLLQRHRLVNECL
AEELPHIHAFEQKTLTPEQWTRQRQE
NT seq 261 nt   +upstreamnt  +downstreamnt
atggaactcagcgctgactacctccgagagaagctgcggcaggacctggaggcagagcat
gtggaggtggaggacacgactctgaaccgttgcgtgaccagcttccgagtcctggtggtg
tcggctaagttcgagggaaagccactgctccagagacaccggctggtgaacgagtgctta
gctgaagagctcccgcacatccatgcctttgagcagaaaactctgaccccagagcagtgg
acccgacagcggcaggaatga

DBGET integrated database retrieval system