KEGG   Rattus norvegicus (rat): 503257Help
Entry
503257            CDS       T01003                                 

Gene name
Nemp2, RGD1560421, Tmem194b
Definition
(RefSeq) nuclear envelope integral membrane protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: NEMP
Motif
Other DBs
NCBI-GeneID: 503257
NCBI-ProteinID: NP_001128114
RGD: 1560421
Ensembl: ENSRNOG00000012924
UniProt: P0C8N6
Position
9q22
AA seq 421 aa AA seqDB search
MPPGSWWLVLWLPPLATLPAGAVPQEEAAMSVPRCKSLKETDLIKTSVSDCYCYNQHSQI
EWTYMWSTVQVTVTSPGLLSIVYITGRHTCQHTETILSFLKCVTHNFWTAEEAKEVTIVF
SPYGETVCFSVKPVGSLLTYAVSVNRNVVDFRLFLVFATGIFLFFYAKTLSQSPVFYYSS
GTVLGILMTLVFVLLMTKKHIPKYSTFGALMIGCWFASVYVLCQLMENLKWLWCGNRIYV
LGYVLVVGLCSFSACYSRGPPADEGSRDLLMWALRFLSLVLVYTGMAISQFAYAVMILLL
LSWTRHYLLRAFSCLRWKVRQWFATRALVVRYLTDDEYREQAEAETASALEELRQACCRP
DFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQYGLGGAFLEEQLFSLQTESLPA
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccccccgggtcgtggtggctggtgctttggctgccgcccctggccacgctgccagcg
ggtgcggtgccccaggaggaggcggcaatgtcagttccaagatgtaaatctctgaaggaa
acggacttaattaaaacttctgtgtcagactgctattgctacaatcaacattcacaaata
gagtggacatatatgtggtcaactgtgcaggtgacggttaccagcccgggcctgctcagt
attgtgtatatcacaggaagacatacttgccagcacacagaaaccattctatcttttctc
aaatgtgtgactcacaacttttggacagcagaggaggctaaggaggtgaccatagtcttc
agtccatacggagagactgtgtgcttctctgtaaagcctgttgggagtttacttacctat
gcagtaagcgtgaatcgaaatgttgtggatttcagactcttccttgtgtttgcgacaggc
attttccttttcttttatgcaaagaccttgagccaaagccctgttttctattactcttcg
ggtaccgtgttaggtattctaatgactctggtctttgtccttctgatgactaagaaacac
atcccgaagtatagcacatttggggcgctaatgattggttgttggtttgcttcagtttat
gttttgtgccagttgatggaaaatctgaagtggctgtggtgtggaaacagaatatatgta
ttaggctatgtcttggttgtcggactttgtagcttttccgcctgttacagtcgcgggcct
cctgctgatgaggggagcagagaccttctgatgtgggcactgaggttcctctccctcgtt
cttgtctacactggtatggccatctctcagtttgcctatgctgttatgatcctgctcctg
ctctcctggactcggcactatctactgagagcattcagctgtctgaggtggaaggtgagg
cagtggtttgcaacacgagcactggtggtgaggtatctcactgatgatgagtacagggag
caagcggaggccgaaacagccagcgctctggaggaactgcgccaagcctgctgccggccc
gacttcccttcctggctagctgtctccagactccaggctcctaaaaagtttgcagagttt
gttcttggagcgagccacctgtcaccggaagaagtcagcacacacgaaaagcagtatggc
cttggaggtgccttcctggaagagcagctctttagcctgcagactgagagtctacctgca
agctga

DBGET integrated database retrieval system