KEGG   Rattus norvegicus (rat): 503429
Entry
503429            CDS       T01003                                 

Gene name
Mpc1l, RGD1563528
Definition
(RefSeq) mitochondrial pyruvate carrier 1-like
  KO
K22138  mitochondrial pyruvate carrier 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    503429 (Mpc1l)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    503429 (Mpc1l)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    503429 (Mpc1l)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC54: Mitochondrial pyruvate carrier
   503429 (Mpc1l)
SSDB
Motif
Pfam: MPC
Other DBs
NCBI-GeneID: 503429
NCBI-ProteinID: NP_001102835
RGD: 1563528
Ensembl: ENSRNOG00000023163
Position
Xq12
AA seq 119 aa
MAAVVALMRKTRDYIKTKEFRDYITSTHFWGPVANWGLPLAAFKDMKAPPDIISGRMTTA
LIFYSMAFMRFAYRVQPRNYLLMACHFTNVLAQSIQASRYLNHRYGGGATAKATKPPAK
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcggcagtagtagcgctaatgcggaaaacacgagattatattaagaccaaggagttt
cgggattatataaccagcacccacttctggggccctgtggccaactggggccttccgctg
gccgcctttaaggatatgaaggcgcctccggacatcatcagcggccgcatgacgaccgcc
ctcatcttctactccatggctttcatgcgctttgcctaccgagtccagcctcgaaactac
ctgctgatggcgtgccatttcaccaacgtgctggcgcagagcatccaggcgagccgttac
ctgaaccaccgctatggtggcggagccacggccaaagccaccaaacctccagccaaataa

DBGET integrated database retrieval system