KEGG   Rattus norvegicus (rat): 503568Help
Entry
503568            CDS       T01003                                 

Gene name
Slc13a4
Definition
(RefSeq) solute carrier family 13 member 4
  KO
K14444  solute carrier family 13 (sodium/sulfate cotransporter), member 1/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    503568 (Slc13a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC13: Human Na+-sulfate/carboxylate cotransporter
   503568 (Slc13a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_sulph_symp CitMHS DUF4519
Motif
Other DBs
NCBI-GeneID: 503568
NCBI-ProteinID: NP_001012639
RGD: 1359715
Ensembl: ENSRNOG00000011184
UniProt: Q5EC47
Position
4q22
AA seq 689 aa AA seqDB search
MGLLQGLLQARKLLLVICVPLLLLPLPTIYPTSGGVELYFQWEMSRFSTFPNLTRMEFYL
HCRRMSLWHQATGMASKDKEHEEAISLNFILFQKEAACAYVLLVTAVYWVSEAVPLGAAA
LVPAFLYPFFGVLRSSEVAAEYFKNTTLLLVGVICVAAAVEKWNLHKRIALRMVLMAGAK
PGMLLLCFMCCTTMLSMWLSNTSTTAMVMPIVEAVLQELINAEEEQLVAGNSSTEEAELM
GVDVSNRQTSVELIFVNEDTSAADFTSLMQNKNLNGVPMVTKSIKTANQQQQKKQHQSQE
KPGVPTPSSKNQELNKKKYRSHHDQMVCKCLSLSISYAATIGGLTTIIGTSTSLIFLEHF
NNQYPAAEVVNFGTWFLFSFPISLIMLVVSWFWMHWLFLGCNFKETCSLSKKKKTRREEL
SERRIREEYEKLGDISYPEMVTAFFFILMTVLWFTREPGFVPGWDSFFEKKGYRTDATVS
VFLGFLLFLIPAKKPCFGKKSDGAGQEASRGIEPIITWKDFQKTMPWEIVILVGGGYALA
SGSKSSGLSTWIGHQMLSLSSLPPWAITLLACVLVSIVTEFVSNPATITIFLPILCTLSE
TLHINPLYTLVPVTMSISFAVMLPVGNPPNAIVFSYGHCQIKDMVKAGLGVNVIGLVIVM
VAINTWGVSLFHLDTFPAWAKVGNITDQT
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgctgcagggccttctccaagcaagaaagctgctattggtcatctgtgtgccg
ctgctgctgctgcccctgcccactatctaccccaccagcgggggagtggaactttatttc
cagtgggaaatgtccagattttccactttcccgaatctcactcggatggaattctatctc
cactgtagaaggatgtctctgtggcatcaggccacaggcatggcttccaaggacaaggag
cacgaggaggccatttctctaaacttcatccttttccaaaaggaggctgcgtgtgcttac
gtgctgcttgtgaccgctgtgtactgggtgtccgaggcggtgcctcttggagctgcagcc
ctcgtgcctgccttcctctacccgttcttcggcgttctccgatccagtgaggtagcggct
gagtacttcaagaacacaacgctgctgttggtgggtgtcatctgcgtggcagcagctgtg
gagaaatggaatttacacaagcgcatcgccctgcgtatggtcttgatggccggagccaag
cctggcatgttactgctgtgcttcatgtgctgtaccaccatgctgtccatgtggctctcc
aacacctccaccaccgccatggtgatgcccatcgtggaggccgtgctgcaggagctgatc
aacgctgaggaggaacagttggtggcgggcaactccagcactgaggaggctgagctcatg
ggtgtggacgtaagcaacagacaaacttctgtagaactcatctttgtcaacgaagacacg
tcggctgcagacttcacttctctgatgcagaacaagaatctgaatggtgtgcccatggtc
accaagtccatcaaaacagcaaaccaacagcaacagaagaagcagcatcaatcacaggaa
aaaccgggagtcccgacccccagctccaagaaccaagaactgaacaagaagaagtacaga
tcccaccatgaccaaatggtctgcaagtgcctctctctgagcatatcttacgctgccacc
attggcggcctgaccaccatcataggcacctccaccagcctcattttcttagagcatttc
aacaaccagtatccggcggcagaggtggtgaacttcgggacctggttcctcttcagcttc
cccatctctctcatcatgctggtggtcagctggttctggatgcattggctcttcctgggc
tgcaactttaaagagacctgctctctgagcaagaagaagaagaccaggagggaggagctg
tcagagaggaggatccgggaggaatatgaaaaactgggagacattagctaccctgaaatg
gtgaccgcatttttcttcatcctgatgacagtgctgtggtttacccgggagcccggcttt
gtccctggctgggattctttctttgaaaagaaaggctaccgcacggacgccaccgtctct
gtattccttggtttcctgctcttcctcatcccagcgaagaagccctgctttgggaagaag
agtgacggagcaggccaggaagcctcccgggggatagagcccatcatcacgtggaaggac
ttccagaaaactatgccctgggagattgtcatcctagtgggaggaggctatgccctggct
tcgggcagcaagagctctggcctctcaacatggattgggcaccagatgctgtccctgagc
agcctcccaccatgggctatcactctgctggcatgcgtcctggtgtccattgtcacagag
tttgtcagcaatccagccaccatcaccatcttcctgcccatcctatgtaccctgtccgaa
acactgcacatcaatccactgtacaccctggtcccggttaccatgtccatctcctttgct
gtaatgctgcctgtgggcaatccccccaatgctatcgtcttcagctatgggcactgccag
atcaaagacatggtgaaagctggcctaggggtcaatgtcatcggcctggtgatagtgatg
gtggccatcaatacttggggagttagtctcttccacttggacactttcccagcctgggct
aaggtcggcaacatcactgatcagacctaa

DBGET integrated database retrieval system