KEGG   Rattus norvegicus (rat): 50522
Entry
50522             CDS       T01003                                 

Gene name
Ubc
Definition
(RefSeq) ubiquitin C
  KO
K08770  ubiquitin C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04137  Mitophagy - animal
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    50522 (Ubc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    50522 (Ubc)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    50522 (Ubc)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    50522 (Ubc)
   05022 Pathways of neurodegeneration - multiple diseases
    50522 (Ubc)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    50522 (Ubc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    50522 (Ubc)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   50522 (Ubc)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 50522
NCBI-ProteinID: NP_059010
RGD: 621244
Ensembl: ENSRNOG00000057823
UniProt: Q63429
Structure
PDB: 
2FUH

Position
12q15
AA seq 810 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI
PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPS
VNTKKVKQEDTRTFLTTVSRKSPSCACSWV
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaaaaccttaactggtaagaccatcaccctggaggtcgagcccagt
gacaccattgaaaatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccag
cagaggctgatctttgcaggcaagcagctggaagatggccgcaccctgtcagactacaac
atccagaaggagtccaccctgcacctggtcctgcgcctcagagggggcatgcagatcttt
gtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagtgacaccattgaa
aatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccagcagaggctgatc
tttgcaggcaagcagctggaagatggccgcaccctgtcagactacaacatccagaaggag
tccaccttgcacctggtccttcgcctcagagggggcatgcagatctttgtgaagaccctg
acaggcaagaccatcaccctggaggtcgagcccagtgacaccattgaaaatgtcaaggca
aagatccaggacaaggagggcatcccccctgaccagcagaggctgatctttgcaggcaag
cagctggaagatggccgcaccctgtcagactacaacatccagaaggagtccaccctgcac
ctggtccttcgcctcagagggggcatgcagatctttgtgaagaccctgacaggcaagacc
atcaccctggaggtcgagcccagtgacaccattgaaaatgtcaaggcaaagatccaggac
aaggagggcatcccccctgaccagcagaggctgatctttgcaggcaagcagctggaagat
ggccgcaccctgtcagactacaacatccagaaggagtccaccctgcacctggtcctgcgc
ctcagagggggcatgcagatctttgtgaagaccctgacaggcaagaccatcaccctggag
gtcgagcccagtgacaccattgaaaatgtcaaggcaaagatccaggacaaggagggcatc
ccccctgaccagcagaggctgatctttgcaggcaagcagctggaagatggccgcaccctg
tcagactacaacatccagaaggagtccaccctgcacctggtccttcgcctcagagggggc
atgcagatctttgtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagt
gacaccattgaaaatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccag
cagaggctgatctttgcaggcaagcagctggaagatggccgcaccctgtcagactacaac
atccagaaggagtccaccctgcacctggtccttcgcctcagagggggcatgcagatcttt
gtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagtgacaccattgaa
aatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccagcagaggctgatc
tttgcaggcaagcagctggaagatggccgcaccctgtcagactacaacatccagaaggag
tccaccctgcacctggtccttcgcctcagagggggcatgcagatctttgtgaagaccctg
acaggcaagaccatcaccctggaggtcgagcccagtgacaccattgaaaatgtcaaggca
aagatccaggacaaggagggcatcccccctgaccagcagaggctgatctttgcaggcaag
cagctggaagatggccgcaccctgtcagactacaacatccagaaggagtccaccctgcac
ctggtcctgcgcctcagagggggcatgcagatctttgtgaagaccctgacaggcaagacc
atcaccctggaggtcgagcccagtgacaccattgaaaatgtcaaggcaaagatccaggac
aaggagggcatcccccctgaccagcagaggctgatctttgcaggcaagcagctggaagat
ggccgcaccctgtcagactacaacatccagaaggagtccaccctgcacctggtcctgcgc
ctcagagggggcatgcagatctttgtgaagaccctgacaggcaagaccatcaccctggag
gtcgagcccagtgacaccattgaaaatgtcaaggcaaagatccaggacaaggagggcatc
ccccctgaccagcagaggctgatctttgcaggcaagcagctggaagatggccgcaccctg
tcagactacaacatccagaaggagtccaccctgcacctggtcctgcgcctcagagggggc
atgcagatctttgtgaagaccctgacaggcaagaccatcactctggaggtcgagcccagt
gttaacaccaagaaggtcaaacaggaagatactcgtacctttctcaccacagtatctaga
aagagcccttcttgtgcttgttcttgggtttga

DBGET integrated database retrieval system