KEGG   Rattus norvegicus (rat): 50551Help
Entry
50551             CDS       T01003                                 

Gene name
Txnrd2, Tr3, Trxr2, Trxrd2
Definition
(RefSeq) thioredoxin reductase 2
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00450  Selenocompound metabolism
rno05200  Pathways in cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    50551 (Txnrd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50551 (Txnrd2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    50551 (Txnrd2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     50551 (Txnrd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 K_oxygenase AlaDh_PNT_C HI0933_like GIDA FAD_oxidored Thi4 Formyl_trans_C NAD_binding_8 DAO
Motif
Other DBs
NCBI-GeneID: 50551
NCBI-ProteinID: NP_072106
RGD: 61960
Ensembl: ENSRNOG00000001890
UniProt: Q9Z0J5
Position
11q23
AA seq 526 aa AA seqDB search
MAAIVAALRGSSGRFRPQTRVLTRGTRGAAGAASAAGGQQNFDLLVIGGGSGGLACAKEA
AQLGRKVAVADYVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAQHYGWEVA
QPVQHNWKAMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVNEHTVHGVDKAGKVTQ
LSAKHIVIATGGRPKYPTQVKGALEHGITSDDIFWLKESPGKTLVVGASYVALECAGFLT
GIGLDTTVMMRSVPLRGFDQQMASLVTEHMESHGTRFLKGCVPSLIRKLPTNQLQVTWED
LASGKEDVGTFDTVLWAIGRVPETRNLNLEKAGVNTNPKNQKIIVDAQEATSVPHIYAIG
DVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMNYSNVPTTVFTPLEYGCVGLSEEEAVAL
HGQEHIEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAGEVTQGFA
LGIQCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLDPTVTGCUG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgattgtggcggcgctgcgcggatccagcgggcgcttccggccgcagacacgg
gttttaacacgcgggacgcggggcgcggcgggcgcggcgagcgcagcgggagggcagcag
aactttgatctcttggtgatcggtgggggatccggtggcctagcttgtgccaaggaagcg
gctcagctgggaaggaaggtggctgtggctgactatgtggaaccctctccccgaggcacc
aaatggggccttggtggcacctgtgtcaacgtgggctgcatacccaagaagctgatgcat
caggccgcactgctggggggcatgatcagagatgctcagcactacggctgggaggtggcc
cagcctgtccagcacaactggaaggcaatggccgaagccgtgcaaaaccatgtgaagtcc
ttgaactggggtcatcgtgtccaactgcaggacaggaaagtcaagtactttaacatcaaa
gccagctttgtcaacgagcacacagttcacggtgtcgacaaagccgggaaggtgactcag
ctttcagccaagcacatagtcatcgctacaggaggacggccgaagtaccccacacaggtc
aaaggagccctggaacacggaatcacaagtgatgacatcttctggctgaaggagtcccct
gggaaaacgttggtggttggagccagttatgtggccctggagtgtgccggcttcctcact
ggtattggcctggataccacggtcatgatgcgcagcgtgcccctccgaggctttgaccag
caaatggcgtctttggtcacagagcacatggagtctcatggcacccggttcctgaaaggc
tgtgtcccctccctcatcagaaaactcccgactaaccaactgcaggtcacttgggaggat
ctcgcttctggcaaggaggacgtgggcacctttgacactgtcctgtgggccatagggcga
gttccagagaccagaaatttgaatctggagaaggctggcgttaataccaaccctaagaat
cagaagatcattgtggatgcccaggaggccacctctgtcccccacatctatgccattgga
gatgttgctgaggggcggcctgagctgacacccacagctatcaaggcaggaaagcttctg
gctcagcggctctttgggaaatcctcaaccttaatgaattacagcaacgtccccacaact
gtctttacaccactggagtatggctgtgtgggactgtctgaggaggaggctgtggctctc
cacggccaggagcatatagaggtttaccatgcatattacaagcccctagagttcacagtg
gcagatcgggatgcatcacagtgctacataaagatggtatgcatgagggagcccccacaa
ctggtactgggcctgcacttccttggccccaacgctggagaagtcacacaaggatttgct
cttgggatccagtgtggggcttcatacgcacaggtgatgcagacagtagggatccacccc
acctgctctgaggaggtggttaagctgcacatctccaagcgctctggcctggatcctact
gtgactggctgctgaggttaa

DBGET integrated database retrieval system