KEGG   Rattus norvegicus (rat): 50554
Entry
50554             CDS       T01003                                 

Gene name
Smad4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04371  Apelin signaling pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04659  Th17 cell differentiation
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05220  Chronic myeloid leukemia
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    50554 (Smad4)
   04350 TGF-beta signaling pathway
    50554 (Smad4)
   04390 Hippo signaling pathway
    50554 (Smad4)
   04371 Apelin signaling pathway
    50554 (Smad4)
   04068 FoxO signaling pathway
    50554 (Smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    50554 (Smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    50554 (Smad4)
   04550 Signaling pathways regulating pluripotency of stem cells
    50554 (Smad4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    50554 (Smad4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50554 (Smad4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    50554 (Smad4)
   05212 Pancreatic cancer
    50554 (Smad4)
   05225 Hepatocellular carcinoma
    50554 (Smad4)
   05226 Gastric cancer
    50554 (Smad4)
   05220 Chronic myeloid leukemia
    50554 (Smad4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    50554 (Smad4)
   05161 Hepatitis B
    50554 (Smad4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    50554 (Smad4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 50554
NCBI-ProteinID: NP_062148
RGD: 3033
Ensembl: ENSRNOG00000051965
UniProt: O70437
Position
18
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLPTEGHSIQ
TIQHPPSNRASTETYSAPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccgacaagcaatgacgcctgtctgagcattgta
cacagtttgatgtgccacagacaaggtggagagagtgagacatttgccaaaagagcaatt
gagagtctggtaaagaagctgaaagagaagaaagatgaactggattctttaataacagct
atcactacaaatggagctcaccccagcaagtgtgtcaccatacagagaacactggatgga
cgactgcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctgtggagg
tggcctgatctacacaagaacgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagcgtctgtgtgaacccatatcactatgagcgggttgtctcacctgga
attgatctctctggattaacactgcagagtaatgctccaccaagtatgttagtgaaggat
gaatatgttcatgactttgaaggacagccatccttacccacggaaggacattcgattcaa
accatccaacatccaccaagtaatcgcgcatccacggagacgtacagcgccccagctctg
ttagccccatcagagtctaatgccaccagtaccaccaacttccccaacattcctgtggct
tccacaagtcagccggccagcattctggcaggcagccatagtgaaggactgttgcagata
gcttcagggcctcagccaggacagcagcagaatggattcactgctcagccagctacttac
caccataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcctggacat
tactggccggttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gaatattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaaa
gtcccttcaagctgtcctattgtaactgtggatggatacgtggatccttctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagctattgagagagcaagg
ttgcacataggcaaaggagtgcagttggagtgtaaaggtgaaggggacgtgtgggtcagg
tgcctcagtgaccacgccgtcttcgtgcagagttactacctggaccgtgaagctggccga
gcacctggtgacgccgtccacaagatctacccgagtgcgtatataaaggtctttgatttg
cggcagtgtcaccggcagatgcagcagcaggcggccaccgcgcaagccgcagctgctgcc
caggcggcagctgtggcaggaaacatccctggtcctgggtccgtaggtggaatagccccg
gccatcagtctgtctgctgctgctggcattggtgtagacgacctccggcgcttgtgcata
ctcaggatgagcttcgtgaagggctggggcccagactacccgagacagagcatcaaagaa
accccgtgctggattgagattcacctccaccgagctctgcagctcctggatgaagtcctg
cacaccatgcccattgcggacccacagcctttagactga

DBGET integrated database retrieval system