KEGG   Rattus norvegicus (rat): 50555Help
Entry
50555             CDS       T01003                                 

Gene name
Ugt8, Ugt8a
Definition
(RefSeq) UDP glycosyltransferase 8
  KO
K04628  ceramide galactosyltransferase [EC:2.4.1.47]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00565  Ether lipid metabolism
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
Module
rno_M00067  Sulfoglycolipids biosynthesis, ceramide/1-alkyl-2-acylglycerol => sulfatide/seminolipid
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    50555 (Ugt8)
   00600 Sphingolipid metabolism
    50555 (Ugt8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    50555 (Ugt8)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.47  N-acylsphingosine galactosyltransferase
     50555 (Ugt8)
Glycosyltransferases [BR:rno01003]
 Glycolipid biosynthesis
  Glycosphingolipid
   50555 (Ugt8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Imm39
Motif
Other DBs
NCBI-GeneID: 50555
NCBI-ProteinID: NP_062149
RGD: 3938
Ensembl: ENSRNOG00000009345
UniProt: Q09426
Position
2q42
AA seq 541 aa AA seqDB search
MKSYTPYFMLLWSAVGIARAAKIIIVPPIMFESHLYIFKTLASALHERGHHTVFLLSEGR
DIDPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGN
QALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEF
NSLLTDRMNFLERMKNTGVYLISRMGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLW
MLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVDGAQEHGFVLVSFGAGVKYL
SEDIANKLAGALGRLPQKVIWRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGG
LNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNP
SYRQRAQKLSEIHKDQPGHPVNRTTYWIDYILRHDGAHHLRSAVHQISFCQYFLLDIAFV
LLLGAVALYFIVSYVTKFIYRKVKSLCSRSTHSTVNGHYQNGILNGRYKGNGHIKHEKKV
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttatactccatatttcatgctcctgtggagtgctgttggaatagcaagggct
gctaaaatcatcattgtgccgccaattatgtttgaaagccatttgtacattttcaagaca
ctagcatcagccttgcacgagagaggccatcacactgtgttcctcctctcagaaggcaga
gacattgacccatctaatcactacagcctccagcgatacccagggatcttcaacagtacc
acctcagatgctttcctgcagtctaaaatgcggaatattttctctggaagattgacagca
gttgaactggttgacatactggatcactatactaagaattgtgacatgatggttggcaac
caagccctaatccagggtttgaaaaaagaaaagtttgacctgctactggttgaccccaat
gatatgtgtggatttgtgatcgctcatcttttaggcgttaagtatgctgtgttttctact
ggcctttggtatcctgctgaagttggagcgcctgctcctttagcttatgtcccagagttt
aactcactcctcacagaccgcatgaacttcctggaaaggatgaaaaatacaggcgtttac
ctcatatccagaatgggggttagctttctggttcttccgaaatatgaaaggataatgcag
aagtacaacctgctccctgcaaagtccatgtatgatttggttcatgggtccagcttgtgg
atgttatgtactgacgtagcactggagtttccaaggcccaccctgcctaacgttgtatat
gttggaggaatcctaacaaagccggccagcccactgccagaagatctgcagaggtgggta
gatggtgctcaggagcatggctttgtcctggtatcttttggagctggtgtcaagtatctg
tcagaagacattgctaacaaactggcaggagctctggggagattgcctcagaaagtgatt
tggaggttttctggaaccaaaccaaagaacctaggaaacaacactaagctcatagaatgg
ttacctcaaaatgacctgcttggccattcaaacatcagagccttcctaagccatggtggt
ttgaacagtatatttgaaactatgtatcatggtgtccctgtagtaggaatcccactcttt
ggagaccattatgatactatgactagagtacaggcgaaaggcatggggatcttgttagaa
tggaatacagttactgaaggggagctgtatgatgcactggtgaaagttatcaacaatccc
agttatcggcagagggctcagaagttatcggaaattcataaggatcaacccggccaccct
gtcaatcggactacctattggatagactacattcttcgccacgacggagcccatcacctc
cgttcggctgtccatcagatctccttctgtcagtattttctactggatattgcctttgtg
cttctgcttggtgctgtcgcgctctacttcatagtgtcctatgtgacaaaatttatctat
agaaaagtcaaaagtctgtgttctaggagtacgcacagcacagttaatggacactaccaa
aatggaatcctcaatggcagatacaaaggaaatggtcatattaaacatgaaaaaaaggta
aaatga

DBGET integrated database retrieval system