KEGG   Rattus norvegicus (rat): 50557
Entry
50557             CDS       T01003                                 

Gene name
Pten, MMAC1, Mmac, TEP1
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04068  FoxO signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04115  p53 signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04510  Focal adhesion
rno04931  Insulin resistance
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05222  Small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05230  Central carbon metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    50557 (Pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    50557 (Pten)
   04070 Phosphatidylinositol signaling system
    50557 (Pten)
   04071 Sphingolipid signaling pathway
    50557 (Pten)
   04151 PI3K-Akt signaling pathway
    50557 (Pten)
   04150 mTOR signaling pathway
    50557 (Pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    50557 (Pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    50557 (Pten)
   04218 Cellular senescence
    50557 (Pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    50557 (Pten)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50557 (Pten)
   05206 MicroRNAs in cancer
    50557 (Pten)
   05230 Central carbon metabolism in cancer
    50557 (Pten)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    50557 (Pten)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    50557 (Pten)
   05214 Glioma
    50557 (Pten)
   05218 Melanoma
    50557 (Pten)
   05215 Prostate cancer
    50557 (Pten)
   05213 Endometrial cancer
    50557 (Pten)
   05224 Breast cancer
    50557 (Pten)
   05222 Small cell lung cancer
    50557 (Pten)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    50557 (Pten)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    50557 (Pten)
   05165 Human papillomavirus infection
    50557 (Pten)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    50557 (Pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    50557 (Pten)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     50557 (Pten)
    3.1.3.48  protein-tyrosine-phosphatase
     50557 (Pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     50557 (Pten)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    50557 (Pten)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Other DBs
NCBI-GeneID: 50557
NCBI-ProteinID: NP_113794
RGD: 61995
Ensembl: ENSRNOG00000020723
UniProt: O54857
Position
1q52
AA seq 403 aa
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKLMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI
DSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHSQITKV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga
ttcgacttagacttgacctatatttatccaaatattattgctatgggatttcctgcagaa
agacttgaaggtgtatacaggaacaatattgatgatgtagtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgagagacattatgacaccgccaaa
tttaactgcagagttgcacagtatccttttgaagaccataacccaccacagctagaactt
atcaaacccttttgtgaagatcttgaccaatggctaagtgaagacgacaatcatgttgca
gcaattcactgtaaagctgggaaaggacggactggtgtaatgatttgtgcatatttattg
catcggggcaagtttttaaaggcacaagaggccctggatttttatggggaagtaaggacc
agagataaaaagggagtaactattcccagtcagaggcgctatgtatattattatagctac
ctgttaaagaatcacctggattacagaccagtggcactgttgtttcacaagatgatgttt
gaaactattccaatgttcagtggcggaacttgcaatccccagtttgtggtctgccagcta
aaggtgaagatctactcctccaactcaggacccacgcggcgggaggacaagctcatgtac
tttgagttccctcagccattgcctgtgtgtggtgacatcaaagtagagttcttccacaaa
cagaacaagatgctcaaaaaggacaaaatgtttcacttttgggtaaatacgttcttcata
ccaggaccagaggaaacctcagaaaaagtggaaaatggaagtctttgtgatcaggaaatc
gatagcatttgtagtatagagcgtgcggataatgacaaggagtatcttgtgctcaccctg
acaaaaaatgatcttgacaaagcaaacaaagacaaggccaaccgatacttctctccaaat
tttaaggtgaagttatacttcacaaaaacagtagaggagccatcaaatccagaggctagc
agttcaacttctgtgactccagacgttagtgacaatgaacctgatcattatagatattct
gacaccactgactctgatccagagaatgaaccttttgatgaagatcagcattcacaaatt
acaaaagtctga

DBGET integrated database retrieval system