KEGG   Rattus norvegicus (rat): 50567Help
Entry
50567             CDS       T01003                                 

Gene name
Slc3a2, Mdu1
Definition
(RefSeq) solute carrier family 3 member 2
  KO
K06519  solute carrier family 3, member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04216  Ferroptosis
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    50567 (Slc3a2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    50567 (Slc3a2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    50567 (Slc3a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    50567 (Slc3a2)
   04147 Exosome [BR:rno04147]
    50567 (Slc3a2)
   04090 CD molecules [BR:rno04090]
    50567 (Slc3a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC3: Heavy subunits of the heteromeric amino acid transporters
   50567 (Slc3a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   50567 (Slc3a2)
CD molecules [BR:rno04090]
 Proteins
  50567 (Slc3a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLC3A2_N Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 50567
NCBI-ProteinID: NP_001258018
RGD: 3073
Ensembl: ENSRNOG00000018487
UniProt: Q794F9
Position
1q43
AA seq 527 aa AA seqDB search
MSQDTEVDMKDVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDEAEAGVKFTGLSKE
ELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRI
GDLQAFVGPEARGIAGLKNHLEYLSTLKVKGLVLGPIHKNQKDEVNETDLKQIDPDLGSQ
EDFKDLLQSAKKKSIHIILDLTPNYKGQNAWFLPPQADIVATKMKEALSSWLQDGVDGFQ
VRDVGKLANASLYLAEWQNITKNFSEDRLLIAGTASSDLQQIVNILESTSDLLLTSSYLS
QPVFTGEHAELLVIKYLNATGSRWCSWSVSQAGLLTSFIPAQFLRLYQLLLFTLPGTPVF
SYGDELGLQAVALPGQPMEAPFMLWNESSNSQTSSPVSLNMTVKGQNEDPGSLLTQFRRL
SDLRGKERSLLHGDFDALSSSSGLFSYVRHWDQNERYLVVLNFQDVGLSARVGASNLPAG
ISLPASANLLLSTDSTRLSREEGTSLSLENLSLNPYEGLLLQFPFVA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggacaccgaagtggacatgaaagatgtggagctgaacgagctggaaccggag
aagcagcctatgaatgcagcggacggggcggcagccggggagaagaacggtctggtgaag
attaaggtggccgaagacgaggcggaagccggggtcaagttcacaggcttatccaaggag
gagctattgaaggtagctggcagcccgggctgggtgcgcacccgctgggcgctgctgctg
ctcttctggctcggttggctgggtatgctggcgggcgccgtggttatcatcgttcgggcg
ccacgctgccgtgagctgccggtacagagatggtggcacaagggcgccctctaccgcatc
ggcgaccttcaggccttcgtaggcccggaagcgagaggcatagctggtctgaagaaccat
ctggagtacttgagcaccctgaaggtgaagggcctagttttgggcccaattcacaagaac
cagaaggatgaagtcaatgaaaccgacttgaaacagattgatcccgatttaggctcccag
gaagattttaaagaccttctacaaagtgccaagaaaaagagcattcacatcattttggac
ctcactcccaactataagggccagaatgcatggttcctccctcctcaggctgacattgta
gccaccaaaatgaaggaggctctgagttcttggttgcaggacggtgtggatggtttccaa
gttcgggatgtgggaaagctggcgaatgcatccttgtacttggctgagtggcagaatatc
accaagaacttcagtgaggacaggcttttgattgcagggaccgcgtcctctgacctgcaa
caaattgtcaacatacttgaatccaccagcgatctgctgctgaccagctcatacctgtca
cagcccgttttcactggggagcatgcagaactcctagtgattaagtatttgaatgccact
ggcagccgctggtgcagctggagtgtgtcgcaggcaggactcctgacatcctttataccg
gctcagtttctccgactctaccagctgctgctcttcactctgccaggaactcctgttttc
agctatggggatgagcttggccttcaggcagttgcccttcctggacagcctatggaggct
ccattcatgctgtggaatgagtctagcaactcccaaacctcaagtcctgtaagcctcaac
atgacagtgaagggccaaaatgaagaccccggctccctcctcacccagttccggcgactg
agtgacctccgtggtaaggagcgctctctgttacacggtgactttgatgcactgtcttcc
tcatctggcctcttctcctacgtccgccactgggaccagaatgagcgttacctggtggtg
ctcaacttccaggatgtgggcctgtcagccagggtaggagcctccaacctccctgctggc
ataagcctgccagccagtgctaaccttttgcttagtactgacagcacccggctaagccgt
gaggagggcacctccctgagcctggaaaacctgagcctgaatccttatgagggcttgttg
ttacagttcccttttgtggcctga

DBGET integrated database retrieval system