KEGG   Rattus norvegicus (rat): 50572Help
Entry
50572             CDS       T01003                                 

Gene name
Slco1a1, OATP-1, Oatp1, Slc21a1, Slc21a3
Definition
(RefSeq) solute carrier organic anion transporter family, member 1a1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1 Yip1
Motif
Other DBs
NCBI-GeneID: 50572
NCBI-ProteinID: NP_058807
RGD: 3700
Ensembl: ENSRNOG00000036984
UniProt: P46720
Position
4q44
AA seq 670 aa AA seqDB search
MEETEKKIATQEGRLFSKMKVFLLSLTCACLTKSLSGVYMNSMLTQIERQFDISTSVAGL
INGSFEIGNLFFIVFVSYFGTKLHRPVVIGIGCVIMGLGCLLMSLPHFFMGRYEYETTIS
PTGNLSSNSFLCMENRTQTLKPTQDPAECVKEMKSLMWICVMVGNIIRGIGETPIVPLGI
SYIEDFAKSENSPLYIGILEMGKVAGPIFGLLLGSYCAQIYVDIGSVNTDDLTITPSDTR
WVGAWWIGFLVCAGVNILTSIPFFFLPKALPKKGQQENVAVTKDGKVEKYGGQAREENLG
ITKDFLTFMKRLFCNPIYMLFILTSVLQVNGFINKFTFLPKYLEQQYGKSTAEAIFLIGV
YSLPPICLGYLIGGFIMKKFKITVKKAAYLAFCLSVFEYLLFLCHFMLTCDNAAVAGLTT
SYKGVQHQLHVESKVLADCNTRCSCSTNTWDPVCGDNGVAYMSACLAGCKKFVGTGTNMV
FQDCSCIQSLGNSSAVLGLCKKGPECANRLQYFLILTIIISFIYSLTAIPGYMVFLRCVK
SEEKSLGVGLHTFCIRVFAGIPAPVYFGALIDRTCLHWGTLKCGQRGACRMYDINSFRHI
YLGLPIALRGSSYLPAFFILILMRKFQFPGDIDSSATDHTEMMLGEKESEHTDVHGSPQV
ENDGELKTKL
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaacagagaaaaagattgcaacacaagagggtagattgttttccaagatgaag
gtgtttctgctgtcattaacatgtgcatgtttaaccaaatcactatcaggagtatatatg
aattccatgctcacacaaatagagagacaatttgatatctccacatctgtagctggatta
atcaatgggagctttgagattggaaacctttttttcattgtatttgtgagttattttgga
acaaaactgcacagacctgtggtgattggtattggatgtgtgattatgggcctggggtgt
ctcttaatgtcattacctcatttcttcatgggcagatacgaatatgaaacaacgatctca
cctacaggcaacttgtcctcaaacagcttcttgtgtatggagaaccgaacacagacctta
aagccaacgcaagacccagcagaatgtgtgaaagaaatgaaatcattaatgtggatatgt
gtaatggtaggaaatattatacgtggaattggtgaaactcctattgtgcccttgggtatc
tcttacatcgaagactttgccaaatcagaaaactctcctttatacattgggattttagaa
atggggaaggttgctggcccaatttttggacttttgttgggatcttactgtgcacaaatt
tatgtagacattgggtctgtgaatacagatgacctgaccataacacccagtgatacacgc
tgggttggtgcttggtggattggctttttggtctgtgcaggagtgaatatcctgaccagc
atcccctttttctttttgccgaaagcacttccaaagaaaggacaacaggagaatgttgct
gtgactaaagatggcaaagttgagaaatatggaggacaagccagagaggaaaatcttgga
atcactaaagatttcttgacgttcatgaagaggctcttctgcaatccgatttacatgctt
ttcatccttacaagtgtgctccaggtgaatggctttattaataaatttacgttcttgccc
aaatacctggaacagcagtatggaaaatctactgcagaggcaatattcctcataggtgtt
tatagcttacctcccatatgcctcgggtatctaattggtggctttattatgaagaagttt
aagattactgtcaagaaagctgcatacctagcattttgcctatcggtgtttgaatatctt
ctttttctttgtcactttatgttgacctgtgacaatgcagcagttgctggattaaccacc
tcttacaaaggagttcagcaccaactacatgtggagagcaaggtccttgctgactgcaac
acaaggtgtagctgctcaacgaacacatgggatccagtgtgtggagacaatggtgtagca
tacatgtcagcttgccttgcgggctgtaagaagtttgttggaactggaaccaacatggtg
tttcaggattgcagctgcattcagtcattaggaaactcgtctgcagtcctgggtctgtgt
aaaaaaggtcctgagtgtgccaacaggctgcagtactttttaatcttaacaataattatc
agtttcatctactcacttacagccatacctgggtacatggtttttttgaggtgtgtcaag
tctgaagagaagtcacttggagttggattacatacattttgcataagagtatttgctggt
attcccgcacctgtttactttggcgctttgatagacagaacctgtttacattggggaacc
ctgaaatgtggtcagcgaggggcatgcaggatgtatgacataaacagtttcaggcacatt
tacctggggttgcctatagcactaagaggatcaagctatctgcctgccttcttcattctg
atacttatgaggaaattccagttccccggggacattgactcttcagcaactgatcataca
gagatgatgctcggagagaaggaaagcgagcacacagatgtgcatggaagtcctcaggtc
gagaatgacggagaactgaaaacgaagctgtaa

DBGET integrated database retrieval system