KEGG   Rattus norvegicus (rat): 50577Help
Entry
50577             CDS       T01003                                 

Gene name
Galr1, Galnr1
Definition
(RefSeq) galanin receptor 1
  KO
K04230  galanin receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    50577 (Galr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    50577 (Galr1)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Neuropeptide
   Galanin [OT]
    50577 (Galr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srd Chitin_synth_1 Bac_rhodopsin
Motif
Other DBs
NCBI-GeneID: 50577
NCBI-ProteinID: NP_037090
RGD: 2656
Ensembl: ENSRNOG00000016654
UniProt: Q62805
Position
18q12.3
AA seq 346 aa AA seqDB search
MELAPVNLSEGNGSDPEPPAEPRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLARS
KPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLV
SIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYYQRLFHRDS
NQTFCWEHWPNQLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEASK
KKTAQTVLVVVVVFGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPII
YAFLSENFRKAYKQVFKCRVCNESPHGDAKEKNRIDTPPSTNCTHV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaactggctccggtgaacctcagtgaagggaatgggagcgaccctgaacctccagcg
gaacccaggccgctcttcggcatcggcgtggagaacttcatcacgctggtggtgtttggc
cttattttcgcgatgggcgtgctgggcaacagcctggtgatcaccgtgctggcgcgcagc
aaaccgggcaagccgcgcagcaccaccaacctgttcatcctcaacctgagcatcgcagac
ctggcctacctgctcttctgcatccctttccaggccaccgtgtacgcactgcccacctgg
gtgctgggcgccttcatctgcaagtttatacactacttcttcaccgtgtccatgctcgtg
agcatcttcaccctggccgcgatgtctgtggatcgctatgtggccattgtgcattcacgg
cgctcctcctccctcagggtgtcccgcaacgcgctgctgggcgtgggcttcatctgggcg
ctgtccatcgctatggcctcgccggtggcctactaccagcgcctttttcatcgggacagc
aaccaaaccttctgctgggagcactggcccaaccaactccacaagaaggcttacgtggtg
tgcactttcgtctttggttaccttctgcccttactgctcatctgcttttgctatgccaag
gttctcaatcatctgcataaaaagttgaagaacatgtcaaaaaagtcagaggcatccaag
aaaaagactgcacagactgtcctggtggtcgttgtggtatttggcatatcatggctgccc
catcatgtcatccacctctgggctgagttcggagcattcccgctgaccccagcttccttc
ttcttcagaatcactgcccactgcctggcatacagcaactcctcggtgaaccccatcatc
tacgcctttctctcagaaaacttccggaaggcgtacaagcaagtgttcaagtgccgtgtt
tgcaatgagtcgccgcacggcgatgctaaagaaaagaaccgaatagataccccgccctcc
accaactgcacccacgtgtga

DBGET integrated database retrieval system