KEGG   Rattus norvegicus (rat): 50592Help
Entry
50592             CDS       T01003                                 

Gene name
Gria1, GluA1, gluR-A
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 1
  KO
K05197  glutamate receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05031  Amphetamine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    50592 (Gria1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    50592 (Gria1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    50592 (Gria1)
   04728 Dopaminergic synapse
    50592 (Gria1)
   04720 Long-term potentiation
    50592 (Gria1)
   04730 Long-term depression
    50592 (Gria1)
   04723 Retrograde endocannabinoid signaling
    50592 (Gria1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    50592 (Gria1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    50592 (Gria1)
  09165 Substance dependence
   05031 Amphetamine addiction
    50592 (Gria1)
   05033 Nicotine addiction
    50592 (Gria1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    50592 (Gria1)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   50592 (Gria1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659
Motif
Other DBs
NCBI-GeneID: 50592
NCBI-ProteinID: NP_113796
RGD: 621531
Ensembl: ENSRNOG00000045816
UniProt: P19490
Structure
PDB: 

Position
10q22
AA seq 907 aa AA seqDB search
MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGGGSGENGRVVSQDFPKSMQSIPCMSHSSGM
PLGATGL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacatctttgcctttttctgcaccggttttctaggtgcggttgtgggtgccaat
ttccccaacaatatccagataggggggttatttccaaaccaacaatcacaggaacatgcg
gcttttaggtttgctttgtcacaactcacggagccccccaagctgcttccccagatcgat
attgtgaacatcagcgacagctttgagatgacttaccgtttctgttcccagttctccaaa
ggagtctatgccatctttggattttatgaacgaaggactgtcaacatgctgacctccttc
tgtggggccctccatgtgtgcttcattactccaagttttcctgttgacacatccaatcaa
tttgtccttcagctacgcccggaactacaggaagctctcattagcattatcgaccattac
aagtggcaaacctttgtctacatttatgatgctgaccggggcctgtcagtcctgcagaga
gtcttggatacagccgcagagaagaactggcaggtaacggctgtcaacattctgacaacc
accgaggaaggataccggatgctctttcaggacctggagaagaaaaaggagaggctggtg
gtggttgactgtgaatcagaacgcctcaacgccatcctgggccagatcgtgaagctagaa
aagaatggcatcgggtaccactacatcctcgccaatctgggcttcatggacattgactta
aataagttcaaggagagcggagccaatgtgacaggtttccagctggtgaactacacagac
acgatcccagccagaatcatgcagcaatggaggacaagtgactcccgagaccataccagg
gtggactggaagaggccaaagtacacttctgctctcacctatgatggtgtcaaggtgatg
gctgaggccttccaaagcctgcggaggcagaggattgacatatcccgccgggggaatgct
ggggactgtctggctaacccagctgtgccctggggtcaagggatcgacatccagagagcc
ctgcagcaggtgcgcttcgaaggtttgacaggaaatgtgcagttcaacgagaaagggcgc
cggaccaattacaccctccacgtgatcgaaatgaaacatgatggaatccgaaagattggt
tactggaatgaagacgataaatttgtccccgcagccaccgacgctcaggctggaggggac
aactcaagcgtccagaataggacctacatcgtcactactatcctcgaagatccttacgtg
atgcttaaaaagaatgccaaccagtttgagggcaatgaccgctatgagggctactgtgtg
gagctggctgcagagatcgccaagcacgtgggctactcctaccgacttgagattgtcagc
gacggcaaatatggagcccgggatcccgacacaaaggcttggaatggcatggtgggagaa
ctggtctatggaagagcagacgtggctgtggctcccttgaccataaccttggtccgggag
gaagtcatcgacttctccaagccattcatgagtttgggaatctccattatgattaagaag
ccacagaagtccaagccaggtgtcttctcctttcttgaccctttggcctatgagatctgg
atgtgtatagtgtttgcctacattggagtgagcgtcgtcctcttcctggtcagccgtttc
agcccctacgaatggcacagcgaagagtttgaagagggacgagaccagacaaccagtgac
cagtcaaatgagtttggcatattcaacagcctgtggttctccctgggggccttcatgcag
caaggatgtgacatttcccccaggtccctgtccggacgcatcgtcggcggcgtctggtgg
ttcttcactttgatcatcatctcctcgtacacagccaacctggctgccttcctgactgtg
gagaggatggtgtctcccattgagagtgcagaggacctggcaaagcagacggaaattgct
tatgggacattggaagcaggctccactaaggagttcttcaggagatctaaaatcgctgtg
tttgagaagatgtggacatacatgaagtctgcagaaccatccgtgtttgttcggaccaca
gaggaaggcatgatcagagtgagaaaatctaaaggcaaatacgcctacctcctggagtcc
accatgaatgagtatattgagcaacgaaagccctgtgacaccatgaaagtgggaggtaac
ttggattccaaaggctatggcattgcgacacccaaggggtccgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaagggcgagtgcggcagcgggggaggtgactccaaggacaagaccagcgct
ttgagcctcagcaatgtggcaggcgtgttctacatcctgattggagggctgggactggcc
atgctggttgccttaatcgagttctgctacaaatcccgtagcgagtcgaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacatcgaccctcccc
cggaacagtggggcaggagccagcggaggaggcggcagtggagagaatggccgggtggtc
agccaggacttccccaagtccatgcaatccattccctgcatgagtcacagttcagggatg
cccttgggagccacaggattgtaa

DBGET integrated database retrieval system