KEGG   Rattus norvegicus (rat): 50599Help
Entry
50599             CDS       T01003                                 

Gene name
Kcnj3
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 3
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    50599 (Kcnj3)
   04915 Estrogen signaling pathway
    50599 (Kcnj3)
   04921 Oxytocin signaling pathway
    50599 (Kcnj3)
  09156 Nervous system
   04724 Glutamatergic synapse
    50599 (Kcnj3)
   04725 Cholinergic synapse
    50599 (Kcnj3)
   04728 Dopaminergic synapse
    50599 (Kcnj3)
   04726 Serotonergic synapse
    50599 (Kcnj3)
   04723 Retrograde endocannabinoid signaling
    50599 (Kcnj3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    50599 (Kcnj3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    50599 (Kcnj3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    50599 (Kcnj3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   50599 (Kcnj3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK
Motif
Other DBs
NCBI-GeneID: 50599
NCBI-ProteinID: NP_113798
RGD: 2958
Ensembl: ENSRNOG00000005369
UniProt: P63251
Position
3q21
AA seq 501 aa AA seqDB search
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
PTRMEGNLPAKLRKMNSDRFT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattaccaggtagtgaccacttcgtccagc
ggttcgggcttgcagccccaggggccaggacagggcccacagcagcagcttgtacccaag
aagaaacggcagcggttcgtggacaagaacggtcggtgcaatgtgcagcacggcaacctg
ggcagcgagaccagtcgctacctttccgacctcttcactaccctggtggatctcaagtgg
cgttggaacctctttatcttcatcctcacctacaccgtggcctggctcttcatggcgtcc
atgtggtgggtgatcgcttatacccggggcgacctgaacaaagcccatgtcggcaactac
actccctgtgtggccaatgtctataacttcccctctgccttccttttcttcatcgagacc
gaggccaccatcggctatggctaccgctacatcaccgacaagtgccccgagggcatcatc
cttttccttttccagtccatccttggctccatcgtggacgctttcctcatcggctgcatg
ttcatcaagatgtcccagcccaaaaagcgcgccgagaccctcatgtttagcgagcatgcg
gttatttccatgagggacggaaaactcactctcatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagatccgctgcaagctgctcaaatctcggcagacacctgag
ggtgagtttctaccccttgaccaacttgaactggatgtaggttttagtacaggggcagat
caactttttcttgtgtcccctctcaccatttgccacgtgattgatgccaaaagccccttt
tatgacctatcccagcgaagcatgcaaactgaacagttcgaggtggtcgtcatcctggaa
ggcatcgtggaaaccacagggatgacttgtcaagctcgaacatcatacaccgaagatgaa
gttctttggggtcatcgttttttccctgtaatttctttagaagaaggattctttaaagtc
gattactcccagttccatgcaacctttgaagtccccacccctccgtacagtgtgaaagag
caggaagaaatgcttctcatgtcttcccctttaatagcaccagccataaccaacagcaaa
gaaagacacaattctgtggagtgcttagatggactagatgacattagcacaaaacttcca
tcgaagctgcagaaaattacggggagagaagactttcccaaaaaactcctgaggatgagt
tctacaacttcagaaaaagcctatagtttgggtgatttgcccatgaaactccaacgaata
agttcggttcctggcaactctgaagaaaaactggtatctaaaaccaccaagatgttatca
gatcccatgagccagtctgtggccgatttgccaccgaagcttcaaaagatggctggagga
cctaccaggatggaagggaatcttccagccaaactaagaaaaatgaactctgaccgcttc
acatag

DBGET integrated database retrieval system