KEGG   Rattus norvegicus (rat): 50645Help
Entry
50645             CDS       T01003                                 

Gene name
Rab27a, ram
Definition
(RefSeq) RAB27A, member RAS oncogene family
  KO
K07885  Ras-related protein Rab-27A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    50645 (Rab27a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    50645 (Rab27a)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    50645 (Rab27a)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    50645 (Rab27a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 TPP_enzyme_M DUF5040 Gtr1_RagA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 50645
NCBI-ProteinID: NP_059013
RGD: 620918
Ensembl: ENSRNOG00000052499
UniProt: P23640
Position
8q24
AA seq 221 aa AA seqDB search
MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDG
TVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMH
AYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISQAIEMLLDL
IMKRMERCVDKSWIPEGVVRSNGHTSTDQLSEEKEKGLCGC
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatggagattatgactacctcatcaagtttttggccttgggagactctggagtg
gggaagaccagtgtactgtaccagtacactgatgggaagttcaactccaaattcatcacc
acagtgggcattgatttcagggaaaagagagtggtgtacagagcgaatggaccagatgga
actgtaggccgaggccagagaattcacctgcagttatgggacacggcggggcaggagagg
tttcgtagcctgaccacggcattcttcagggacgctatgggtttcctgcttctgttcgac
ctgacaaacgagcaaagtttcctcaatgtccgaaactggataagccagctacagatgcac
gcgtactgcgaaaacccagatatagtgctctgcggaaataagagtgacctagaagaccag
agggctgtgaaagaggaggaagccagggaactcgcagagaagtatggaatcccctatttt
gaaaccagcgctgccaatgggacaaacataagccaagcaattgagatgctcctggacctg
atcatgaagcggatggagcggtgtgtggacaaatcctggattccagagggggtggtgcgg
tccaatggccatacttctacagatcaactcagtgaggagaaggagaaggggttatgcggc
tgttga

DBGET integrated database retrieval system