KEGG   Rattus norvegicus (rat): 50646Help
Entry
50646             CDS       T01003                                 

Gene name
Ptk2b, CAK_beta, CAKB, CAKbeta, Pyk2
Definition
(RefSeq) protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04670  Leukocyte transendothelial migration
rno04912  GnRH signaling pathway
rno05135  Yersinia infection
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    50646 (Ptk2b)
   04072 Phospholipase D signaling pathway
    50646 (Ptk2b)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    50646 (Ptk2b)
   04670 Leukocyte transendothelial migration
    50646 (Ptk2b)
   04062 Chemokine signaling pathway
    50646 (Ptk2b)
  09152 Endocrine system
   04912 GnRH signaling pathway
    50646 (Ptk2b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    50646 (Ptk2b)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    50646 (Ptk2b)
   05161 Hepatitis B
    50646 (Ptk2b)
   05163 Human cytomegalovirus infection
    50646 (Ptk2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    50646 (Ptk2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     50646 (Ptk2b)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  FAK family
   50646 (Ptk2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 50646
NCBI-ProteinID: NP_059014
RGD: 628758
Ensembl: ENSRNOG00000027839
UniProt: P70600
Position
15p12
AA seq 1009 aa AA seqDB search
MSGVSEPLSRVKVGTLRPPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDTKPTCLA
EFKQIRSIRCLPLEETQAVLQLGIEGAPQSLSIKTSSLAEAENMADLIDGYCRLQGEHKG
SLIIHAKKDGEKRNSLPQIPTLNLESRRSHLSESCSIESDIYAEIPDETLRRPGGPQYGV
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIVMELYPYGELGHYLERNKNSLKVPTLVLYALQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPELCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMERDIAIEQERNARYRPPKILEPTAFQEPPPKPSRP
KYKHPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKIKMRQVLDRQQKQMVEDSQWLRREERCLDPMVYMNDKSP
LTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYHNVMTLVEAVLELKNKLSQ
LPPEEYVVVVKNVGLNLRKLIGSVDDLLPSLPASSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEDCKRQMLTASHTLAVDAKNLLDAVDQAKVVANLAHPPAE
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggtgtctgagcccctgagccgtgtaaaagtgggcactttgcgcccgcccgag
ggccccccagagcccatggtagtggtaccagtagacgtggagaaggaagacgtgcgtatc
ctcaaggtctgcttctacagcaacagcttcaacccagggaagaacttcaagcttgtcaaa
tgcacagtgcagacagagatccaggagatcatcacctccatcctcctgagtgggcgaata
gggcccaacatccagctggctgaatgctatgggctgaggctgaagcacatgaagtcagat
gagatccactggctgcacccacagatgactgtgggcgaagtgcaggacaagtatgaatgt
ctacacgtggaggctgagtggaggtatgaccttcaaatccgctatttgccagaagacttc
atggagagcctgaaagaagacaggactacactgctgtacttttatcaacagctccggaat
gactacatgcaacgctatgccagcaaggtcagtgaaggcatggctctgcagctgggctgt
ctggagctcaggagattcttcaaggacatgccccacaatgcacttgacaaaaagtccaac
tttgaactcctggaaaaagaagtcggtctggacctgtttttcccaaagcaaatgcaggaa
aacttaaagcccaagcagttccggaagatgatccagcagaccttccagcagtatgcatca
ctccgggaggaagagtgtgtcatgaaattcttcaatactctggcaggctttgccaacatc
gaccaggagacctatcgctgtgaactcattcaagggtggaacattactgtggacctggtc
attggccctaaaggcatccgtcagctgacaagtcaagacacaaagcccacctgcctcgcc
gagttcaagcagatcagatccatcaggtgcctccccttggaagagacccaggcagtactg
cagctgggcatcgagggtgccccccagtccttgtccatcaaaacctcgtccctggcagag
gctgagaacatggctgacctcatagatggctactgcaggcttcaaggagagcataaaggc
tctctcatcattcatgccaagaaagatggtgagaagaggaacagcctgcctcagatcccc
acactaaacctggagtctcggcggtcccacctctcagaaagctgtagcatagagtcagac
atctatgcagagattcctgatgagaccctgcgaaggccaggaggcccacagtatggtgtt
gcccgtgaagatgtagttcttaaccgcattctgggtgaaggcttcttcggggaggtctac
gaaggtgtctacacgaaccataaaggggaaaaaattaatgtggccgtcaagacctgtaag
aaagattgtaccctggacaacaaggagaagttcatgagtgaggcagtgatcatgaagaat
cttgaccaccctcacatcgtcaagctgattggcatcattgaagaggaacccacatggatc
gtcatggaactgtatccttatggggagctgggacactacctggagcgaaataaaaattcc
ctgaaggtacccactctggtcctgtacgctctgcagatatgcaaagccatggcctatctg
gagagcatcaactgtgtccacagggatattgctgtccggaacatcctggtggcctctcct
gagtgtgtgaagctcggggactttgggctctcccggtacattgaggatgaggactattac
aaagcttccgtgacccgtctccccatcaaatggatgtcccccgagtccatcaactttcgc
cgctttacaaccgccagtgacgtctggatgtttgctgtatgcatgtgggagatcctcagc
tttgggaagcagcctttcttctggcttgaaaacaaggatgtcatcggggtgctggagaaa
ggggacaggctgcctaagcccgaactctgcccgcctgtcctttacacactcatgacccgc
tgctgggactatgaccccagcgaccggccccgctttacggagcttgtgtgcagtctcagt
gacatttatcagatggagagggacattgcaatagaacaagaaaggaacgctcgttaccga
ccccccaaaatattggagcccactgcttttcaggaacccccacccaagcccagccggccc
aagtacaaacaccctccacagaccaatctgctggctcctaagctgcagttccaggtccct
gagggtctgtgtgccagctctcctacacttacgagccctatggagtatccatctccagtt
aactcgctgcacaccccgcctctgcaccgacacaatgtcttcaagcgccacagcatgcgg
gaggaggacttcatccggcccagtagtcgagaagaggcccagcagctctgggaggcagag
aagatcaagatgaggcaggtcctagacagacagcagaagcaaatggtggaagattcccag
tggctgaggcgggaggaaagatgcttggacccgatggtttatatgaatgacaagtcccca
ctgaccccagagaaggaggccggctacacggagttcacagggcccccccagaagccacca
cggctcggtgcacagtccatccagcctacagccaacttggacaggactgatgacctcgtg
taccacaatgtcatgaccctggtggaggccgtgctggaactcaagaacaagctcagccag
ctgcctcctgaggagtatgtggtggtggtgaagaatgtggggctgaacctgcggaagctc
atcggtagcgtggacgatctcctaccctccttgccagcatcttctagaacagagattgaa
gggacccagaaactgctcaacaaagacctggcagagctcatcaacaagatgaggttggct
cagcagaacgctgtgacatccctaagtgaggactgcaagcggcagatgctcacagcatcc
cataccctggctgtggatgccaagaacctcctggatgctgtagaccaagccaaggttgtg
gctaatctggcccacccgcctgcagagtga

DBGET integrated database retrieval system