KEGG   Rattus norvegicus (rat): 50654Help
Entry
50654             CDS       T01003                                 

Gene name
Ctss
Definition
(RefSeq) cathepsin S
  KO
K01368  cathepsin S [EC:3.4.22.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04145  Phagosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    50654 (Ctss)
   04142 Lysosome
    50654 (Ctss)
  09143 Cell growth and death
   04210 Apoptosis
    50654 (Ctss)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    50654 (Ctss)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    50654 (Ctss)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    50654 (Ctss)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    50654 (Ctss)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     50654 (Ctss)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C1: papain family
   50654 (Ctss)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   50654 (Ctss)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 50654
NCBI-ProteinID: NP_059016
RGD: 621513
UniProt: Q02765
Position
2q34
AA seq 330 aa AA seqDB search
MAVLGAPGVLCDNGATAERPTLDHHWDLWKKTRMRRNTDQNEEDVRRLIWEKNLKFIMLH
NLEHSMGMHSYSVGMNHMGDMTPEEVIGYMGSLRIPRPWNRSGTLKSSSNQTLPDSVDWR
EKGCVTNVKYQGSCGSCWAFSAEGALEGQLKLKTGKLVSLSAQNLVDCSTEEKYGNKGCG
GGFMTEAFQYIIDTSIDSEASYPYKAMDEKCLYDPKNRAATCSRYIELPFGDEEALKEAV
ATKGPVSVGIDDASHSSFFLYQSGVYDDPSCTENMNHGVLVVGYGTLDGKDYWLVKNSWG
LHFGDQGYIRMARNNKNHCGIASYCSYPEI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggctgttttgggtgcccctggtgtgctctgtgacaatggagcaactgcagagagacct
accctggaccaccactgggatctctggaagaaaactcgcatgagaaggaatacagatcag
aatgaagaagacgtacgacgtctcatctgggaaaagaatctcaagtttataatgcttcac
aatctggaacattctatgggaatgcattcatacagtgtgggcatgaaccacatgggagac
atgacacctgaagaagtcataggttatatgggctctctgagaattcccaggccctggaat
agaagtggcactctcaagtcaagctctaatcagacattgcccgactctgtggactggcga
gaaaagggctgcgtcactaatgtgaaataccagggctcttgtggttcctgctgggctttc
agcgccgagggggcccttgaagggcagctgaagctgaaaacggggaagctggtgtctctc
agtgctcagaacctggtggattgctcaaccgaagaaaagtacgggaataaaggctgcggg
ggtggcttcatgaccgaagctttccagtacatcatcgatacgagcatcgactcagaagct
tcctatccctacaaagccatggatgaaaagtgtctctatgacccaaaaaatcgagctgcc
acgtgttcaaggtacattgagctccccttcggcgatgaagaagctctgaaagaagcagtg
gccactaaagggcctgtctctgtgggcatcgacgacgccagccattcctccttcttcctc
taccaaagtggtgtctatgatgacccctcctgtaccgagaatatgaatcatggtgttctc
gtggttggctatgggactcttgatgggaaagactactggcttgtgaaaaacagttggggc
cttcactttggtgatcaaggatatattcggatggcgagaaataacaaaaatcactgcggg
attgctagctattgctcttacccagaaatctaa

DBGET integrated database retrieval system