KEGG   Rattus norvegicus (rat): 50655
Entry
50655             CDS       T01003                                 

Gene name
Aco1
Definition
(RefSeq) cytoplasmic aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01210  2-Oxocarboxylic acid metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    50655 (Aco1)
   00630 Glyoxylate and dicarboxylate metabolism
    50655 (Aco1)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     50655 (Aco1)
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-GeneID: 50655
NCBI-ProteinID: NP_059017
RGD: 2019
Ensembl: ENSRNOG00000005849
UniProt: Q63270
Position
5
AA seq 889 aa
MKNPFAHLAEPLDPAQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFLVKKNDI
ENILNWSIMQHKSIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPA
DLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFCNMRIIPPGSGIIHQV
NLEYLARVVFDQDGCYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLP
QVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDNVSIAYLVQTGREEDKVKHIKRYLQAVGMFRDFSDSSQDPDFTQVVE
LDLKTVVPCCSGPKRPQDKVAVSEMKRDFESCLGAKQGFKGFQVAPDHHNDHKTFIYNDS
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLNVKPYVKTSLSPGSGVVTY
YLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQGQQVFLKDIWPTRDEIQEVE
RKYVIPGMFKEVYQKIETVNKSWNALAAPSEKLYAWNPKSTYIKSPPFFESLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYGSRRGNDAIMA
RGTFANIRLLNKFLNKQAPQTVHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGSGSSR
DWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGETADSLGLTGRERYTIHIP
EDLKPRMKVQIKLDTGKTFQAVMRFDTDVELTYFHNGGILNYMIRKMAQ
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgaagaatccatttgcgcaccttgccgagcccttggaccctgcacagccaggaaagaaa
ttcttcaacttgaataaattggaggactcaagatatggacgcttaccattctctatcaga
gttctcctggaggccgccgttcggaactgtgacgagtttttggtgaagaagaatgacatt
gagaatatcctgaactggagtatcatgcagcataagagcatagaagtgccgtttaagcca
gcccgagtcatactgcaggactttacgggcgtgcctgctgtggttgattttgcagcaatg
cgcgatgctgtgaagaagttgggaggaaatccagagaaaataaaccctgtctgccccgct
gaccttgtaatcgatcattccatccaggttgatttcaacagaagggcagacagtttgcag
aagaatcaagacctggaatttgaaaggaatagagaacgatttgaatttttaaagtggggt
tcccaggccttttgcaacatgaggattattcctcctggctcaggaattattcaccaagtg
aatctggagtatttggcaagagtagtgtttgatcaggatggatgttactacccagatagc
ctcgtgggcacagattctcacaccaccatgattgatggtctgggagttcttggttggggt
gtaggtggtattgaagcagaagctgtcatgctgggtcagccaatcagcatggtgcttccc
caggtgattggctacaagctgatggggaagcctcaccctctggtaacctccacggacatt
gtgctcaccattaccaagcacctccgacaagttggggtcgtgggcaaattcgtggagttt
ttcgggccaggagtggcccagctgtccattgctgaccgagctacgattgccaacatgtgc
ccagagtacggcgcgacggcagccttcttcccggtcgacaacgttagcatcgcgtacctg
gtgcagacaggtcgtgaggaagacaaagtaaagcacattaaaaggtatcttcaggctgta
ggcatgtttcgagacttcagtgactcctctcaagacccagacttcactcaggtcgtggag
ttagatttgaaaacagttgtgccttgctgcagtggacctaaaagacctcaggacaaagtt
gctgtgtctgagatgaaaagggactttgaaagctgccttggagccaagcaaggatttaaa
ggttttcaagttgctccagaccatcacaatgaccacaagacgtttatctataacgacagt
gaattcactcttgctcatggctccgtggtgatcgccgccatcactagctgcacaaacacc
agcaatccgtccgtgatgttaggcgcaggattgttagcaaagaaagccgtagaggcgggg
ctgaatgtgaagccttacgtcaaaaccagcctgtctcctgggagtggagtggtcacctac
taccttcgagagagtggagtcatgccttacctgtcccagttagggtttgacgtggtgggc
tacggctgcatgacctgcatcggcaacagtggacccctccccgaacctgtggtggaggct
atcacccagggagaccttgtggctgttggggtactgtctggaaacaggaattttgaagga
cgagtccatcctaacacccgggccaactacttagcatctcccccactagtaatagcatat
gcaattgcaggcaccgtcaggatcgacttcgagaaagagcctttgggagtgaacgcacag
ggccaacaagtgtttctgaaggatatctggccaactcgagatgagatccaggaggtggag
cggaagtatgtcatccccggcatgttcaaggaggtctatcagaagatagagactgtaaac
aaaagctggaatgccttagcagccccttcagagaagctgtatgcgtggaaccccaagtct
acttatatcaagtcaccgccattctttgaaagcttgactttagatctccagccccccaag
tctatagtggatgcctatgtgctactaaatctaggagattccgtaacaacggatcatatc
tctccagcggggaacattgcaagaaacagccctgccgctcgctacttgacgaacagaggc
ctgacgccacgagatttcaactcctacggctcccgccggggtaacgacgccatcatggca
cgggggacatttgccaacattcgcttgctgaacaagtttctgaacaagcaggcccctcag
actgtccaccttccttcaggagaaaccctcgatgtgttcgatgccgctgagcggtaccag
caggctggacttcccctgattgttctggctggcaaagagtacggttcaggcagctcccga
gactgggcagccaaaggtcctttcctgctgggaatcaaagctgtcctggcagagagctac
gagcgcattcatcgcagcaacctggttggcatgggggtgatcccccttgagtatctcccc
ggcgaaactgcagactctctgggactcacgggtcgggaaaggtacacgatccacattccc
gaagaccttaagccccgcatgaaggttcagataaagctggacaccgggaagaccttccag
gccgtgatgaggttcgacaccgacgtggagctcacttacttccacaatggaggcatcctg
aactacatgatccgaaagatggcccagtag

DBGET integrated database retrieval system