KEGG   Rattus norvegicus (rat): 50665Help
Entry
50665             CDS       T01003                                 

Gene name
Tmsb10, Ptmb10, THYb10
Definition
(RefSeq) thymosin, beta 10
  KO
K13785  thymosin beta 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    50665 (Tmsb10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin DUF4522 WH2
Motif
Other DBs
NCBI-GeneID: 50665
NCBI-ProteinID: NP_067084
RGD: 62022
Ensembl: ENSRNOG00000042499
UniProt: P63312
Position
4q31
AA seq 44 aa AA seqDB search
MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaagccggacatgggggaaatcgccagcttcgataaggccaagctgaagaaa
accgagacgcaggagaagaacaccctgccgaccaaagagaccattgaacaggaaaagagg
agtgaaatctcctaa

DBGET integrated database retrieval system