KEGG   Rattus norvegicus (rat): 50669
Entry
50669             CDS       T01003                                 

Gene name
Prf1, Cyta, RATCYTA
Definition
(RefSeq) perforin 1
  KO
K07818  perforin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04210  Apoptosis
rno04650  Natural killer cell mediated cytotoxicity
rno04940  Type I diabetes mellitus
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    50669 (Prf1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    50669 (Prf1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    50669 (Prf1)
   05330 Allograft rejection
    50669 (Prf1)
   05332 Graft-versus-host disease
    50669 (Prf1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    50669 (Prf1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    50669 (Prf1)
SSDB
Motif
Pfam: MACPF C2
Other DBs
NCBI-GeneID: 50669
NCBI-ProteinID: NP_059026
RGD: 708463
UniProt: Q5FVS5
Position
20q11
AA seq 554 aa
MAAYLFLLGLFLLLPRPVPAPCYTATRSECKQKHKFVPGVWAAGEGVDVTTLRRSSSFPV
NTGKFLRPDRTCTLCKNALMNDAIQRLPVAIAHWRPHGSHCQRNVATTKVSSTEGVAREA
AANINNDWRAGLDVNPKPEANVHVSVAGSHSKIANFAAEKAHQDQYNFNTDTVECRMYSF
RLAQKPPLHPDFRKALKNLPHNFNSSTEHAYRRLISSYGTHFITAVDLGGRVSVLTALRT
CQLTLDGLTADEVGDCLSVEAQVSIGAQASVSSEYKACEEKKKQHKIATSFHQTYRERHV
EVLGGPLDSSNDLLFGNQATPEHFSTWIASLPTRPDVVDYSLEPLHILLEDSDPKREALR
QAISHYVMSRARWRDCNRPCRAGQHKSSRDSCQCVCQDSKVTNQDCCPRQRGLAKLMVRN
FQAKGLWGDYITSTDAYLKVFFGGQEIRTGVVWNNNHPSWSDKMDFGNVLLSTGGPLRVQ
VWDADNGWDDDLLGTCDKSPKSGFHEVNCPLNHGSIKFIYQANCLPHLTGETCLEYAPQG
LLGDPPGNRSGAVW
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggccgcgtacctgttcctcctgggccttttcctgctgctgccacgacctgtccctgct
ccctgctacactgccactcggtcagaatgcaagcagaagcacaaattcgtgcctggtgtg
tgggcggctggggaaggtgtggatgtgaccaccctccgccgctccagctccttcccagtg
aacacagggaagttcctgaggcctgaccgcacctgcaccctctgtaaaaacgccctgatg
aatgacgctatacagcgcctacccgtggcaatcgcccactggcggcctcacggctcacac
tgccagcgtaatgtggccacaaccaaggtcagctccacggagggtgtggcgcgggaggcg
gctgctaatatcaataacgactggcgtgcggggctggatgtgaaccctaaaccggaagca
aacgtgcatgtgtccgtggctggctcccattccaagatagccaattttgcagccgagaag
gcccatcaggaccaatacaactttaatactgacacagtggagtgtcgcatgtacagtttt
cgcctggcacaaaagcctccactccaccctgacttcagaaaggcactcaagaaccttccc
cacaactttaacagctccacagagcatgcttaccgtagactcatctcttcctatgggact
cattttattacggctgtggacctaggtggccgcgtctcggtcctcacggctctgcgtacc
tgtcagctgaccctggatgggctcacagctgatgaggtaggagactgcttgagcgtggaa
gcccaggtcagcatcggtgcccaagccagtgtctcaagcgaatacaaagcttgcgaggag
aagaagaaacaacacaaaatcgccacctctttccaccagacctaccgtgagcgtcatgtc
gaagtgctcggtggcccccttgactcctcgaatgacctgctcttcgggaaccaagctacc
cctgagcacttctctacctggatagcctcattgcccaccaggcctgatgtggtggactac
agcctggagcccctgcacatactactggaagactcggacccgaagcgagaggcactgaga
caggctatcagccattatgtgatgagcagggctcgctggcgagactgtaaccggccctgc
agggcaggccagcataagagtagtcgtgattcatgccagtgtgtgtgccaggattcgaag
gtcaccaaccaggactgctgcccacgccagaggggcttggccaagttgatggtaaggaat
ttccaggccaagggtctgtggggggactacatcacatctacggatgcttatctgaaggtc
ttctttggtggccaggagatcaggaccggtgtagtgtggaacaataaccatccctcgtgg
agtgacaagatggactttgggaatgtgctcctgtccacagggggacccctcagggtgcag
gtctgggatgctgacaatggctgggatgatgaccttcttggtacttgtgacaagtctccc
aagtctggtttccatgaggtgaattgtcccctgaaccacggcagtataaaattcatctac
caggccaattgcttgccccatctcactggagagacctgcctggagtatgccccccagggg
cttctaggagatccaccaggaaaccgcagtggggctgtgtggtaa

DBGET integrated database retrieval system