KEGG   Rattus norvegicus (rat): 50671
Entry
50671             CDS       T01003                                 

Gene name
Fasn
Definition
(RefSeq) fatty acid synthase
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00061  Fatty acid biosynthesis
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
Module
rno_M00082  Fatty acid biosynthesis, initiation
rno_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    50671 (Fasn)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    50671 (Fasn)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    50671 (Fasn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    50671 (Fasn)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    50671 (Fasn)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     50671 (Fasn)
Lipid biosynthesis proteins [BR:rno01004]
 Fatty acid synthase
  Animal type
   50671 (Fasn)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   50671 (Fasn)
  Exosomal proteins of breast milk
   50671 (Fasn)
  Exosomal proteins of colorectal cancer cells
   50671 (Fasn)
  Exosomal proteins of bladder cancer cells
   50671 (Fasn)
SSDB
Motif
Pfam: Acyl_transf_1 ketoacyl-synt Thioesterase KR KAsynt_C_assoc Ketoacyl-synt_C PS-DH ADH_zinc_N ADH_zinc_N_2 Methyltransf_12 PP-binding adh_short Methyltransf_31 Methyltransf_23 Methyltransf_25 Methyltransf_11 Thiolase_N adh_short_C2 YjeF_N L27 ACP_syn_III
Other DBs
NCBI-GeneID: 50671
NCBI-ProteinID: NP_059028
RGD: 620665
Ensembl: ENSRNOG00000045636
UniProt: P12785
Structure
PDB: 
2PNG

Position
10q32.3
AA seq 2505 aa
MEEVVIAGMSGKLPESENLQEFWANLIGGVDMVTDDDRRWKAGLYGLPKRSGKLKDLSKF
DASFFGVHPKQAHTMDPQLRLLLEVSYEAIVDGGINPASLRGTNTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLLALQNAYQAIRSGEC
PAAIVGGINLLLKPNTSVQFMKLGMLSPDGTCRSFDDSGNGYCRAEAVVAVLLTKKSLAR
RVYATILNAGTNTDGCKEQGVTFPSGEAQEQLIRSLYQPGGVAPESLEYIEAHGTGTKVG
DPQELNGITRSLCAFRQSPLLIGSTKSNMGHPEPASGLAALTKVLLSLENGVWAPNLHFH
NPNPEIPALLDGRLQVVDRPLPVRGGIVGINSFGFGGANVHVILQPNTQQAPAPAPHAAL
PHLLHASGRTMEAVQGLLEQGRQHSQDLAFVSMLNDIAATPTAAMPFRGYTVLGVEGHVQ
EVQQVPASQRPLWFICSGMGTQWRGMGLSLMRLDSFRESILRSDEALKPLGVKVSDLLLS
TDEHTFDDIVHSFVSLTAIQIALIDLLTSMGLKPDGIIGHSLGEVACGYADGCLSQREAV
LAAYWRGQCIKDANLPAGSMAAVGLSWEECKQRCPPGVVPACHNSEDTVTISGPQAAVNE
FVEQLKQEGVFAKEVRTGGLAFHSYFMEGIAPTLLQALKKVIREPRPRSARWLSTSIPEA
QWQSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGVKPSCT
IIPLMKRDHKDNLEFFLTNLGKVHLTGIDINPNALFPPVEFPVPRGTPLISPHIKWDHSQ
TWDIPVAEDFPNGSSSSSATVYNIDASSESSDHYLVDHCIDGRVLFPGTGYLYLVWKTLA
RSLSLSLEETPVVFENVTFHQATILPRTGTVPLEVRLLEASHAFEVSDSGNLIVSGKVYQ
WEDPDSKLFDHPEVPIPAESESVSRLTQGEVYKELRLRGYDYGPHFQGVYEATLEGEQGK
LLWKDNWVTFMDTMLQISILGFSKQSLQLPTRVTAIYIDPATHLQKVYMLEGDTQVADVT
TSRCLGVTVSGGVYISRLQTTATSRRQQEQLVPTLEKFVFTPHVEPECLSESAILQKELQ
LCKGLAKALQTKATQQGLKMTVPGLEDLPQHGLPRLLAAACQLQLNGNLQLELGEVLARE
RLLLPEDPLISGLLNSQALKACIDTALENLSTLKMKVVEVLAGEGHLYSHISALLNTQPM
LQLEYTATDRHPQALKDVQTKLQQHDVAQGQWDPSGPAPTNLGALDLVVCNCALATLGDP
ALALDNMVAALKDGGFLLMHTVLKGHALGETLACLPSEVQPGPSFLSQEEWESLFSRKAL
HLVGLKKSFYGTALFLCRRLSPQDKPIFLPVEDTSFQWVDSLKSILATSSSQPVWLTAMN
CPTSGVVGLVNCLRKEPGGHRIRCILLSNLSSTSHVPKLDPGSSELQKVLESDLVMNVYR
DGAWGAFRHFQLEQDKPEEQTAHAFVNVLTRGDLASIRWVSSPLKHMQPPSSSGAQLCTV
YYASLNFRDIMLATGKLSPDAIPGKWASRDCMLGMEFSGRDKCGRRVMGLVPAEGLATSV
LLSPDFLWDVPSSWTLEEAASVPVVYTTAYYSLVVRGRIQHGETVLIHSGSGGVGQAAIS
IALSLGCRVFTTVGSAEKRAYLQARFPQLDDTSFANSRDTSFEQHVLLHTGGKGVDLVLN
SLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDALFEGANDS
WREVAELLKAGIRDGVVKPLKCTVFPKAQVEDAFRYMAQGKHIGKVLVQVREEEPEAMLP
GAQPTLISAISKTFCPEHKSYIITGGLGGFGLELARWLVLRGAQRLVLTSRSGIRTGYQA
KHVREWRRQGIHVLVSTSNVSSLEGARALIAEATKLGPVGGVFNLAMVLRDAMLENQTPE
LFQDVNKPKYNGTLNLDRATREACPELDYFVAFSSVSCGRGNAGQSNYGFANSTMERICE
QRRHDGLPGLAVQWGAIGDVGIILEAMGTNDTVVGGTLPQRISSCMEVLDLFLNQPHAVL
SSFVLVEKKAVAHGDGEAQRDLVKAVAHILGIRDLAGINLDSSLADLGLDSLMGVEVRQI
LEREHDLVLPIREVRQLTLRKLQEMSSKAGSDTELAAPKSKNDTSLKQAQLNLSILLVNP
EGPTLTRLNSVQSSERPLFLVHPIEGSITVFHSLAAKLSVPTYGLQCTQAAPLDSIPNLA
AYYIDCIKQVQPEGPHRVAGYSFGACVAFEMCSQLQAQQGPAPAHNNLFLFDGSHTYVLA
YTQSYRAKLTPGCEAEAEAEAICFFIKQFVDAEHSKVLEALLPLKSLEDRVAAAVDLITR
SHQSLDRRDLSFAAVSFYYKLRAADQYKPKAKYHGNVILLRAKTGGTYGEDLGADYNLSQ
VCDGKVSVHIIEGDHRTLLEGRGLESIINIIHSSLAEPRVSVREG
NT seq 7518 nt   +upstreamnt  +downstreamnt
atggaggaggtggtgatagccggtatgtccgggaaattgcccgagtcagagaacctgcag
gagttctgggccaacctcattggcggtgtggacatggtcacagacgatgacaggaggtgg
aaggctgggctctatgggttgcctaagcggtctggaaagctgaaggatctgtccaagttc
gacgcctccttttttggggtccaccccaagcaggcacacacaatggacccgcagctccgg
ctgctgctggaagtcagctatgaagctattgtggacggaggtatcaacccggcctcactc
cgaggaacaaacactggtgtctgggtgggtgtgagtggttccgaggcgtcggaggccctg
agcagagatcctgagactcttctgggctacagcatggtgggctgccagagagcaatgatg
gccaaccggctctctttcttcttcgacttcaaaggacccagcattgccctggacacagcc
tgctcctctagcctactggcactacagaatgcctatcaggctatccgcagtggggagtgc
cctgctgccattgtgggcgggatcaacctgctgctaaagcctaacacctctgtgcagttc
atgaagctaggcatgctcagccccgatggcacctgcagatcctttgatgattcagggaac
gggtattgccgtgctgaggctgtcgtggcagttctgctgactaagaagtccttggctcgg
cgagtctatgccactattctgaatgccgggacgaacacagatggctgcaaggagcaaggc
gtgacattcccctctggagaagcccaggaacaactcatccgttctctgtatcagccgggc
ggtgtggcccccgagtctcttgaatatattgaagcccatggcacgggcaccaaggtgggg
gacccccaggaactgaacggcattactcggtccctgtgtgctttccgccagagccctttg
ttaattggctccaccaaatccaacatgggacaccctgagcctgcctcggggcttgcagcc
ctgaccaaggtgctgttatccctagaaaatggggtttgggcccccaacctgcatttccac
aaccccaaccctgaaatcccagcacttcttgatgggcggctgcaggtggtcgataggccc
ctgcctgttcgtggtggcatcgtgggcatcaactcgtttggcttcggaggtgccaatgtt
cacgtcatcctccagcccaacacacagcaggccccagcacctgccccacatgctgcccta
ccgcatttgctgcatgccagtggacggaccatggaggcagtgcagggcctgctggaacag
ggccgccagcacagtcaggacttggcctttgtgagcatgctcaatgacattgcagcaacc
cctacagcagccatgcccttcagaggttacactgtgttaggtgttgagggccatgtccag
gaagtgcagcaagtgcctgccagccagcgcccactctggttcatctgctcagggatgggc
acacagtggcgtggaatggggctgagccttatgcgcctggacagtttccgtgagtccatc
ctgcgctctgatgaggctctgaagcccttgggagtcaaagtgtcagacctgctgctgagc
actgatgagcacacctttgatgacatcgtgcattcctttgtgagcctcaccgccatccag
attgccctcatcgacctgctgacgtctatggggctgaaacctgatggcatcattgggcac
tccttgggagaggttgcctgtggctatgcagatggctgtctctcccagagagaggctgtg
cttgcagcctactggagaggccagtgcattaaggatgccaaccttccggctggatccatg
gcagctgttggtttgtcctgggaagaatgtaaacaacgctgccctcctggtgtggtgcct
gcctgccacaactctgaggacactgtgaccatctctggacctcaggctgcagtgaatgaa
tttgtggagcagctaaagcaagagggcgtgtttgccaaggaggtgcgaacaggtggcctg
gccttccactcctacttcatggaaggaattgcccccacgctgctgcaggctctcaagaag
gtgatccgggagccacggccacgctcagcacgctggctcagcacctctatccctgaggcc
cagtggcagagcagcctggcccgcacatcttctgctgagtacaacgtcaacaacctggtg
agccctgtgctcttccaggaagcactgtggcacgtccccgagcacgccgtggtgctggag
attgcaccccatgcactgttgcaggctgtcctgaagcgaggcgtgaagcctagctgcacc
atcatccccttgatgaagagggaccataaagataacttggagttcttcctcaccaacctc
ggcaaggtgcacctcacaggcatcgacatcaaccctaatgccttgttcccacctgtggaa
ttcccggttccccgagggactcctctcatctcccctcacatcaagtgggaccacagtcag
acttgggatatcccagttgctgaagacttccccaacggttccagctcctcctcagctaca
gtctacaacattgacgccagttccgagtcatctgaccactacctggtcgaccactgcatt
gacggccgtgtcctcttccctggcactggctacctgtacctggtgtggaagacactggct
cgaagcctgagcttgtccctagaagagacccctgtggtgtttgagaacgtgacatttcat
caggccaccatcctgcccaggacaggaaccgtgcctctggaggtgcggctgctagaggcc
tcacatgcatttgaggtgtctgacagtggcaacctgatagtgagcgggaaagtgtaccag
tgggaagaccctgactccaagttattcgaccacccagaagtcccgatccccgccgagtcc
gagtctgtctcccgcttgacgcagggagaagtatacaaggagctgcggctacgtggctat
gactatggccctcatttccagggcgtctatgaggccaccctcgaaggtgagcaaggcaag
ctgctctggaaagacaactgggtgaccttcatggacacaatgctgcagatatccatcctg
ggcttcagcaagcagagtctgcagctacccacccgtgtgactgccatctatattgaccct
gcaacccacctgcagaaggtgtacatgctggagggagacactcaagtggctgacgtgacc
acgagccgctgtctgggcgtgaccgtctctggtggtgtctacatttcgagactacagaca
acagcaacctcacggcggcagcaggaacagctggtccccaccctggagaagtttgtcttc
acaccccatgtggagcctgagtgcctgtctgagagtgctatcctgcagaaagagctgcag
ctgtgcaagggtctggcaaaggctctgcagaccaaggccacccagcaagggctgaagatg
acagtgcctgggctagaggaccttccccagcatggactgcctcgactcttggctgctgcc
tgccagctgcagctcaacgggaacctgcaactggagttaggtgaggtactggctcgagag
aggctcctgctgccagaagaccctctgatcagtggcctccttaactcccaggccctcaag
gcctgcatagacacagccctggagaacctgtctactctcaagatgaaggtggtggaggtg
ctggctggagaaggccacttgtattcccacatctcagcactgctcaacacccagcctatg
ctgcaactggagtatacagccaccgaccggcacccccaggccctgaaggatgttcagacc
aagctgcagcagcatgatgtagcacagggccagtgggacccttctggtcctgctcctacc
aacctgggtgctcttgaccttgtggtgtgcaactgtgcgttagccaccctgggggatcca
gccctggccctggacaacatggtagctgccctcaaggatggtggtttcctgctaatgcac
acagtgctcaaaggacatgcccttggggaaaccctggcctgcctcccttctgaggtgcag
cctgggcccagcttcttaagccaggaagagtgggagagcctgttctcaaggaaggcactg
cacctggtgggccttaaaaagtcattctacggtactgcgctgttcctgtgccgccgtctc
agcccacaggacaagcccatcttcctgcctgtggaggatactagtttccagtgggtggac
tctctgaagagcattctggccacatcctcctcccagcctgtgtggctaacagccatgaac
tgccccacctcaggtgtggtaggcttggtgaactgtctccgaaaagagccgggtggacac
cggattcggtgtatcctgctgtccaacctcagcagcacatctcacgtccccaagctggac
cctggctcttcagagctacagaaggtgctagagagtgatctggtgatgaacgtgtacagg
gacggtgcctggggtgccttccgtcacttccagttagagcaggacaagcccgaggagcag
acagcacatgcctttgtaaacgtccttacccgaggggaccttgcctccatccgctgggtc
tcttctcccctgaaacacatgcagccgccctcgagctcaggagcacagctctgcactgtc
tactatgcctcactgaacttccgagatatcatgctggccacgggcaagctgtcccctgat
gccattccaggtaaatgggccagccgggactgcatgcttggcatggagttctcaggccgt
gataagtgcggccggcgtgtgatggggctggtacccgcagaaggcctggccacctcagtc
ctgttatcacccgacttcctctgggatgtaccctctagctggaccctggaggaggcggct
tctgtgcctgttgtctacaccaccgcctactactccttagtagtgcgtggtcgtattcag
cacggggaaactgtgctcattcactcgggctccggtggtgtgggccaagcggccatttcc
attgcccttagcctgggctgccgagtcttcaccactgtgggctccgctgagaagcgagct
tacctccaggccagattccctcagctggatgacaccagctttgctaactctcgagacaca
tcgtttgagcagcatgtgttactgcacacaggtggcaaaggggtggacctggtcctcaac
tccctggcagaagagaagctgcaggccagtgtgcggtgcttggctcagcatggccgcttc
ctagagatcggcaaatttgatctttctaacaaccaccctctgggcatggccatcttcttg
aagaacgtcactttccatgggatcctgctggatgcactttttgagggggccaacgacagc
tggcgggaggtggcagagctgctgaaggccggcatccgtgatggggttgtgaagcctctc
aagtgtacagtgtttcccaaggcccaggtggaggacgccttccgatacatggctcaagga
aaacatattggcaaagtccttgtccaggtacgggaggaggagcccgaggctatgctgcca
ggggctcagcccaccctgatttccgccatctccaagaccttctgcccagagcataagagt
tacatcatcactggtggcctaggtggctttggcctggaactggcccggtggcttgtgctt
cgtggggcccaaaggcttgtactaacttcccgatctggaatccgcacaggctaccaagcc
aagcacgttcgggagtggaggcgccagggcatccatgtgctagtgtcgacaagcaatgtc
agttcactggagggggcccgtgctctcatcgctgaagccacaaagcttgggcccgttgga
ggtgtcttcaacctggccatggttttaagggatgccatgctggagaaccagactccagaa
ctcttccaggatgtcaacaagcccaagtacaatggcaccctgaaccttgacagggcgacc
cgggaagcctgtcctgagctggactactttgtggccttctcctctgtaagctgcgggcgt
ggtaatgctggccaatccaactatggcttcgccaactctaccatggagcgtatttgcgaa
cagcgccggcacgatggcctcccaggtcttgccgtgcaatggggtgccattggtgacgtg
ggcattatcttggaagcgatgggtaccaatgacacagtcgttggcggcacactgccacag
cgcatctcctcctgcatggaggtgctggacctcttcctgaatcagccccacgcagtcctg
agcagttttgtgctggttgagaagaaagctgtggcccatggtgatggtgaagcccagagg
gatctggtgaaagcagtggcacacatcctaggcatccgcgacctcgcagggattaacctg
gacagctcgctggcagacctcggcctggactcgctcatgggtgtggaagtgcgccagatc
ctggaacgtgaacatgatctggtgctacccattcgtgaagtacggcaactcacactgcgg
aagcttcaggaaatgtcctccaaggctggctcagacactgagttggcagcccccaagtcc
aagaatgatacatccctgaagcaggcccagctgaatctgagtatcctgctggtgaaccct
gagggccctaccttaacacgactcaactcagtgcagagctctgagcggcctctgttcctg
gtgcaccccattgaaggttccatcactgtgttccacagcctggctgccaagctcagtgtg
cccacctacggtctgcagtgcacccaagcggcccccctggacagcattccaaacctggct
gcctactacattgattgcatcaagcaggtgcagcctgaggggccccaccgagtggctggg
tattcttttggagcttgtgtagccttcgagatgtgctcccagctgcaggcccagcagggc
ccagcccccgcccacaacaacctcttcttgtttgatggctcacacacctacgtattggcg
tacacccagagctaccgggcaaagctgaccccaggctgtgaggctgaggctgaagctgaa
gccatatgcttcttcattaagcagtttgttgatgcagagcatagcaaggtgctagaggcc
ctgctaccactgaagagcctggaggaccgggttgctgctgctgtggacctcatcactaga
agccaccagagcctggaccgccgtgacctgagctttgctgccgtgtccttctactacaag
cttcgagccgccgaccagtataaacccaaggccaagtaccacggcaatgtgatcctgctg
cgggccaagacaggtggcacctacggcgaggacttgggtgccgattacaacctgtcccag
gtgtgtgatgggaaggtgtctgtgcacatcattgagggtgaccatcgtacgctgctggag
ggcaggggcctggagtctatcatcaacatcatccacagctccctggctgagcctcgagtg
agtgtacgggagggctag

DBGET integrated database retrieval system