KEGG   Rattus norvegicus (rat): 50681Help
Entry
50681             CDS       T01003                                 

Gene name
Acox1, RATACOA1, aCoA
Definition
(RefSeq) acyl-CoA oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno00410  beta-Alanine metabolism
rno00592  alpha-Linolenic acid metabolism
rno00640  Propanoate metabolism
rno01040  Biosynthesis of unsaturated fatty acids
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04024  cAMP signaling pathway
rno04146  Peroxisome
Module
rno_M00087  beta-Oxidation
rno_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    50681 (Acox1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    50681 (Acox1)
   00592 alpha-Linolenic acid metabolism
    50681 (Acox1)
   01040 Biosynthesis of unsaturated fatty acids
    50681 (Acox1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    50681 (Acox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    50681 (Acox1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    50681 (Acox1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    50681 (Acox1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     50681 (Acox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 50681
NCBI-ProteinID: NP_059036
RGD: 619757
Ensembl: ENSRNOG00000008755
UniProt: P07872
Structure
PDB: 

Position
10q32.1
AA seq 661 aa AA seqDB search
MNPDLRKERASATFNPELITHILDGSPENTRRRREIENLILNDPDFQHEDYNFLTRSQRY
EVAVKKSATMVKKMREYGISDPEEIMWFKKLYLANFVEPVGLNYSMFIPTLLNQGTTAQQ
EKWMRPSQELQIIGTYAQTEMGHGTHLRGLETTATYDPKTQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITQGECYGLHAFVVPIREIGTHKPLPGITVGDIGPKFGYEEMDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGNAAQSLSKACTIA
IRYSAVRRQSEIKQSEPEPQILDFQTQQYKLFPLLATAYAFHFVGRYMKETYLRINESIG
QGDLSELPELHALTAGLKAFTTWTANAGIEECRMACGGHGYSHSSGIPNIYVTFTPACTF
EGENTVMMLQTARFLMKIYDQVRSGKLVGGMVSYLNDLPSQRIQPQQVAVWPTMVDINSL
EGLTEAYKLRAARLVEIAAKNLQTHVSHRKSKEVAWNLTSVDLVRASEAHCHYVVVKVFS
DKLPKIQDKAVQAVLRNLCLLYSLYGISQKGGDFLEGSIITGAQLSQVNARILELLTLIR
PNAVALVDAFDFKDMTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYHKHLKPLQSK
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgacctgcgcaaggagcgggcctccgccaccttcaatccggagttgatcacg
cacatcttggatggcagtccggagaatacccggcgccgtcgagaaattgagaacttgatt
ctgaacgacccagacttccagcatgaggactataacttcctcactcgaagccagcgttat
gaggtggctgttaagaagagtgccaccatggtgaagaagatgagggaatatggcatctcg
gaccctgaagaaatcatgtggtttaaaaaactatatttggccaattttgtggaacctgtt
ggcctcaattactccatgtttattcctaccttgctgaatcagggcaccactgctcagcag
gagaaatggatgcgcccgtcccaagaactccagataattggcacctacgcccagacggag
atgggccacggaactcatcttcgaggcttggaaaccactgccacatatgaccccaagacc
caagagttcattctcaacagccctactgtgacttccattaagtggtggcctgggggactt
gggaaaacttccaatcacgcaatagttctggctcagctcatcactcaaggagagtgctac
gggttacatgcctttgttgtccctatccgtgaaattgggacccacaagcccttgccaggc
atcactgtcggggatatcggtcccaaatttggttatgaagagatggataacggctacctg
aagatggacaattaccgtattcccagagagaacatgctgatgaaatacgcccaggtgaag
cctgatggcacatatgtaaagcctttgagtaacaagctgacgtatgggaccatggttttt
gtgaggtccttcctcgtgggaaatgcagctcagagtctgtccaaggcttgcacaatcgcc
atacgatacagcgctgtgaggcgccagtctgaaatcaagcaaagcgaaccagaaccacag
attttggattttcaaacccagcagtataaactcttcccgctcctggccactgcctatgcc
ttccacttcgtaggaaggtacatgaaggagacctaccttcgaattaatgagagcattggc
caaggggacctgagtgaactgcctgagcttcacgccctcactgctgggctgaaggctttt
actacttggacagccaatgctggcatcgaagaatgtcgaatggcctgcggcgggcacggc
tattctcacagcagtgggattccaaatatttacgtcacttttaccccggcctgcaccttc
gagggagagaacactgttatgatgctgcagacagccaggttcttgatgaaaatctacgac
caggtgcggtcggggaagttggtgggtggtatggtgtcatacctgaatgacctgccgagt
cagcggatccagccacagcaggtggcagtctggccaactatggtggacatcaacagcctg
gagggcctgacagaagcctacaagcttcgtgcagccagattggtagaaatcgctgcaaaa
aaccttcagactcacgtgagtcacaggaagagcaaggaagtagcatggaacctaacctct
gtcgaccttgttcgggcaagtgaggcgcattgccactacgtggtcgttaaggtcttctca
gacaaactccccaagattcaagacaaagccgtccaagctgtgctgaggaacctgtgtctc
ttgtattctctctatgggatcagccagaaaggaggggactttcttgaggggagcatcatc
acaggggctcagctgtcacaagtaaacgctcggatcctggagctgctcaccctgatccgc
cccaatgctgttgctctggtggatgcctttgactttaaggacatgacacttggctctgtt
cttggccgctatgatggaaatgtgtatgaaaacttgtttgagtgggccaagaaatcccca
ctgaacaaaacagaggtccatgaatcttaccacaagcacttgaagcccctgcagtccaag
ctttga

DBGET integrated database retrieval system