KEGG   Rattus norvegicus (rat): 50682
Entry
50682             CDS       T01003                                 

Symbol
Lipf
Name
(RefSeq) gastric triacylglycerol lipase precursor
  KO
K14452  gastric triacylglycerol lipase [EC:3.1.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno01100  Metabolic pathways
rno04975  Fat digestion and absorption
Module
rno_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    50682 (Lipf)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    50682 (Lipf)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     50682 (Lipf)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydro_lipase Hydrolase_4 Esterase Abhydrolase_6
Other DBs
NCBI-GeneID: 50682
NCBI-ProteinID: NP_059037
RGD: 708441
Ensembl: ENSRNOG00000019448
UniProt: P04634
Position
1
AA seq 395 aa
MWLLLITSVISTFGGAHGLFGKLGPGNPEANMNISQMITYWGYPCQEYEVVTEDGYILGV
YRIPHGKNNSENIGKRPVVYLQHGLIASATNWIANLPNNSLAFMLADAGYDVWLGNSRGN
TWSRKNVYYSPDSVEFWAFSFDEMAKYDLPATINFIVQKTGQEKIHYVGHSQGTTIGFIA
FSTNPTLAKKIKTFYALAPVATVKYTQSPLKKISFIPTFLFKLMFGKKMFLPHTYFDDFL
GTEVCSREVLDLLCSNTLFIFCGFDKKNLNVSRFDVYLGHNPAGTSVQDFLHWAQLVRSG
KFQAFNWGSPSQNMLHYNQKTPPEYDVSAMTVPVAVWNGGNDILADPQDVAMLLPKLSNL
LFHKEILAYNHLDFIWAMDAPQEVYNEMISMMAED
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtggctgttattaataacaagtgtgatatcaacattcggaggtgcacatggcctattt
ggaaaactgggtcctggaaaccctgaagcaaatatgaatattagtcagatgataacttac
tggggatatccatgtcaagaatatgaagttgttactgaagatggctacattctgggggtc
tacagaattcctcatgggaagaataattctgaaaatataggcaagagacctgtggtgtat
ttgcagcatggtttgatcgcatcagccacaaactggattgcaaatctaccaaacaacagc
ctggcctttatgctagcagacgctggctatgatgtgtggctggggaacagtcgaggaaat
acatggtccaggaaaaatgtatactactcaccagactcagttgaattctgggctttcagc
tttgatgaaatggctaaatatgaccttcccgccacaataaacttcattgtacagaaaact
ggacaagagaagatacactatgttggtcattctcagggcaccactattggtttcattgcc
ttttctaccaatcctacactggccaaaaaaatcaagacgttttatgcattagctccagtt
gctaccgtgaagtatacacaaagtcccttgaaaaagatttcatttattcctacatttctt
ttcaagcttatgtttggcaagaaaatgttcctgccccacacctactttgatgactttctt
ggtaccgaagtgtgctcacgggaggttctagatcttctctgcagcaacactttattcatc
ttctgtggatttgacaagaaaaacttaaatgtgagtcgttttgatgtgtatctagggcat
aatccagcagggacatctgttcaagactttctccactgggcacagcttgttagatctggg
aaatttcaagccttcaactggggaagcccatcccagaacatgttacactacaaccagaaa
acgcctcctgaatatgatgtgtcagccatgactgtgccagttgcagtgtggaacggtggc
aatgacatcctggctgatccccaagatgtcgccatgctgcttcccaaactctccaacctc
ctgttccataaggagattcttgcctacaatcacctggacttcatctgggcaatggatgcc
cctcaagaggtttacaatgagatgatttccatgatggcagaagactaa

DBGET integrated database retrieval system