KEGG   Rattus norvegicus (rat): 50692
Entry
50692             CDS       T01003                                 

Gene name
Plaur, Par, Plaur3, uPAR, uPAR-2, uPAR-3
Definition
(RefSeq) plasminogen activator, urokinase receptor
  KO
K03985  plasminogen activator, urokinase receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    50692 (Plaur)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    50692 (Plaur)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    50692 (Plaur)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    50692 (Plaur)
CD molecules [BR:rno04090]
 Proteins
  50692 (Plaur)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  50692 (Plaur)
SSDB
Motif
Pfam: UPAR_LY6 UPAR_LY6_2
Other DBs
NCBI-GeneID: 50692
NCBI-ProteinID: NP_059046
RGD: 620597
Ensembl: ENSRNOG00000037931
UniProt: P49616
Position
1q21
AA seq 328 aa
MGLLRRRLLLLVVVVTTCVPASQGLRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAE
ELEVVTRGLCHKEKTNRTMSYRMGSVIVSLTETVSATNLCNRPRPGARGRPFPRGRYLEC
ASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAG
FHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEESSFIDCRGP
MNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTGG
APGPGPAHLILIASLLLTLRLWGIPLWT
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggcctcctgaggcggcggctgctgctgctggtggtggtagtgacgacctgtgtccca
gcctcccagggcctgcggtgcatacagtgcgaaagtaaccaggactgcctggtggaggag
tgtgccctgggccaggacctctgcagaaccacggtgcttcgggaatgggaagacgccgag
gagctggaggtggtgaccagaggcctgtgccacaaggagaagaccaacaggaccatgagc
taccgcatgggctcggtgatcgtcagcctcaccgagaccgtgagtgccacaaacctctgc
aacaggcccagacccggagcccgagggcgaccttttccccggggccgttaccttgagtgt
gcatcctgcacctctctggaccagagctgtgagaggggccgggagcaaagcctgcagtgc
cggtatcctacagaacactgtattgaagtggtgacgctccaaagcacagaacggagcgtg
aaggacgaaccctacaccaaaggctgtggcagtcttcccggatgcccgggcacagcaggt
ttccatagcaaccagacctttcacttcctgaagtgctgcaacttcacccaatgcaatggt
ggcccagttctggatcttcagagcttaccaccgaatggcttccaatgttacagctgtgag
gggaacagcacctttggatgttcctacgaagagagctccttcattgactgccggggacca
atgaatcagtgcttggaggctacaggcttagatgtgctgggaaaccggagttacaccgta
agaggctgcgccacggcttcctggtgccaaggttcccacgtggccgactccttccagacc
cacgtcaacctctctatctcctgctgtaatggcagtggctgtaaccgccctacagggggc
gcccccgggccaggccctgctcatcttatcctcattgcctccctgctcctgaccctcaga
ctgtggggcatccctctctggacctga

DBGET integrated database retrieval system