KEGG   Rattus norvegicus (rat): 50871
Entry
50871             CDS       T01003                                 

Gene name
Hpcal1, NVP-3, Nvp3, VILIP-3
Definition
(RefSeq) hippocalcin-like 1
  KO
K23847   
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Other DBs
NCBI-GeneID: 50871
NCBI-ProteinID: NP_059052
RGD: 708375
Ensembl: ENSRNOG00000005492
UniProt: P62749
Position
6q16
AA seq 193 aa
MGKQNSKLRPEVLQDLREHTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIV
RLLQCDPSSASQF
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggcaagcagaacagcaaactgcggcctgaggtgctgcaggacctgcgggaacacaca
gagttcactgaccatgagctgcaggagtggtataagggcttcctcaaggactgtcccacc
ggccacttgacagtggacgaattcaagaagatctacgccaacttcttcccctatggcgac
gcctctaagtttgccgaacacgtcttccgcacctttgacaccaacagcgatggcaccatc
gacttccgggagttcatcatcgcactgagcgtgacctctcggggcaagctggagcagaag
ctcaagtgggccttcagcatgtacgacctggacggcaacggctacatcagccgcagtgaa
atgctggagattgtgcaggccatctacaagatggtgtcctccgtgatgaagatgcccgag
gatgagtccacacccgagaagcgaacagacaagatcttcaggcagatggacacaaacaat
gatggcaaactgtccctggaagaattcatcaaaggtgccaagagcgacccgtccattgtc
cggttgctgcagtgtgaccccagcagtgctagccagttctga

DBGET integrated database retrieval system