KEGG   Rattus norvegicus (rat): 50938Help
Entry
50938             CDS       T01003                                 

Gene name
Cdon, Cdo
Definition
(RefSeq) cell adhesion associated, oncogene regulated
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    50938 (Cdon)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_6 Ig_4 Ig_5 Izumo-Ig Pur_ac_phosph_N Tissue_fac TNFR_16_TM
Motif
Other DBs
NCBI-GeneID: 50938
NCBI-ProteinID: NP_059054
RGD: 708433
Ensembl: ENSRNOG00000011789
UniProt: O35158
Position
8q21
AA seq 1256 aa AA seqDB search
MHPDLGPLWKLLYVLVILCSSVSSDLATYFISEPLSAVQKLGRPVVLHCSAKPVTARISW
LHNGKRLDRNTEQIKIHRGTLTILSLNPSLSGCYQCVANNSVGAVVSGPATVSADALADF
DSSTMHVITAEKKNTGFIGCRVPESNPKAEVRYKIRGKWLMYSTGNYIILPSGNLQILNV
SSKDKGSYKCAAYNPVTSELKVEPAGRKLLVSRPSSDGFHILHPALSQALAVLPHSPVTL
ECVVSGVPASQVYWLKDGQDCLSGSNWRRLYSHLATASIDPADSGNYSCVVGNNSSGDVK
HVTYTVNVLEHASISKGLHDQKVSLGATVRFTCEVHGNPAPNRTWFHNAQPIRPSSRHLT
EGSVLKITGVIMEDSGLYQCMADNGIGFMQSTGRLQIEQDSGQRPVIVTAPANVEVTDGD
FVTLSCNATGEPVPVIHWYGRHGLITSHPSQVLRSKSRKSHLFRPGDLDPEPVYLIMSQA
GSSSLSIQAVTREHAGKYTCEAVNKHGSTQSEAFLTVVPFETNTKAEPVTPSEASQNDER
DPRDGSESGLLNLFPVKVHSGGVELPAEKNASVPDAPNILSPPQTHMPDTYTLVWRTGRD
GGMPINAYFVKYRKLDDGSGAVGSWHTVRVPGSESELHLTELEPSSLYEVLMVARSAVGE
GQPAMLTFRTSKEKMASSKNTQASFPPVGIPKRPVTSEASNSNFGVVLTDSSRHSGVPEA
PDRPTISMASETSVYVTWIPRANGGSPITAFKVEYKRMKSSDWLVAAEDIPPSKLSVEVR
SLEPGSIYKFRVIVINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSDTQI
MLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHTIGHLQPETSYDIK
MQCFNEGGESEFSNVMICETKVKRVPGASEYPMKELSTPPSSSGNGGNVGPATSPARSSD
MLYLIVGCVLGVMVLILLVFIALCLWKSRQQSAIQKYDPPGYLYQGSEINGQMVEYTTLS
GTARINGSVHGGFLSKGSLSNGCSHLHHKGPNGVNGILNGTINGGLYSAHTSSLTRTCVE
FEHPHHLVNGGAVYTAVPQMDPLECINCRNCRNNNRCFTKTNSPLPVVPVVASYPQDGLE
MKPLGVMKFPVCPVSTVPDGGQIPEECLKDSVAPAPTQRTCRQDNTSDINSDSTEDTAEF
NRGDSSGHSEAEDKVFSWSPLILSPVLEDCSEKTAWSPPGPPLDGLSVVLQQAQET
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgcatccagacctcggacccttatggaaactgctgtatgttcttgtgattctgtgttct
tctgtgagctcagacttggcaacttattttatttctgagccactctctgctgtccagaag
cttggcagacccgtggtcctacattgttctgctaaacctgttactgcccgaatctcatgg
ttgcataatggaaaacgattggacagaaacacagaacagataaagatccaccgggggact
ttgaccattctgtctctcaacccttccctttctggttgctaccagtgtgtggccaacaac
agtgttggggctgttgtcagtggccctgccacagtgtccgctgacgccctggctgatttc
gattcatcaacaatgcatgttattactgcagagaagaaaaacacgggtttcattggctgc
agggtacctgagagtaaccccaaagctgaggtgcgctacaagatccggggaaagtggctg
atgtattccacagggaactacataatccttccctcaggaaatcttcagattttgaatgta
tcctcgaaggataagggatcgtacaagtgtgctgcctataatcctgtcaccagtgaactg
aaagttgaacccgctggccggaagctccttgtgagtcgtccttcctcggatggttttcac
attcttcaccctgctctttctcaggcattagctgtccttccgcacagccctgttaccttg
gagtgtgtagtgagtggggtccccgcctcacaagtgtattggctgaaggacgggcaggat
tgcctgtcaggaagcaactggagaaggctgtactctcacctggccacagctagcatcgac
ccagcggattccgggaactattcctgtgtggtgggcaacaacagttccggagatgttaaa
cacgtcacttacacagtcaacgtactggagcacgcttcaatttctaaagggctgcacgat
cagaaggtgtccctgggggccaccgtacgttttacctgcgaagttcacgggaacccagcc
cccaaccgcacctggtttcataacgcacagcccatccgcccctcctcacggcatctgacg
gaaggaagtgttctgaagatcaccggggtcatcatggaggattctgggttgtatcagtgc
atggcagacaatgggattggatttatgcaatctactggaagacttcaaattgaacaagac
agtggacagaggcctgtcatagtcaccgccccagcaaacgtagaggtgacggacggagac
ttcgtgactttgtcttgcaatgccacaggagagcctgtcccggtcattcattggtacggc
cgccatggattgataaccagccatccatctcaggtccttaggtccaaatctcgaaagtcc
cacctcttccgacctggggacctggacccggagcctgtctacctcatcatgtcccaagcg
ggctcgagctctctgtccatccaggcagtgactcgggagcatgctgggaaatacacttgc
gaagctgtgaacaaacatggcagcacacagtcagaagcgttcctcacagtcgttcctttt
gaaacaaacacaaaggcagagccagtcacaccctccgaagcttctcagaacgatgaacga
gacccacgagacggttcagagtccggcttgctgaacttgtttccagtgaaggtgcattcc
ggtggagtggaattgccagcagagaaaaatgcctctgtccccgatgctcctaacatactg
agccccccacagacccacatgccagacacatacaccctggtgtggaggacggggagggat
ggcggaatgcccatcaacgcctatttcgtgaagtaccgaaagctggacgacggcagtggt
gcggtaggcagctggcacacggttcgcgtcccagggagtgagagcgagctgcatctaacc
gaactggagccttcaagcctttatgaagttttgatggtggccagaagtgcagtcggcgaa
ggacagcctgccatgcttaccttccggaccagcaaagaaaagatggcatcatcaaaaaac
acccaggcgtcctttccacctgtgggcatccctaagcggcctgtaacttcggaggcttcc
aacagcaattttggagttgtgcttacggattcctctaggcatagtggagtcccagaggca
ccagatcgacctactatctcgatggcatcggagacctcagtctatgtcacctggattccc
cgtgcaaatggcggctctcccatcactgccttcaaggtggaatataagcggatgaaaagt
agtgactggctggtggctgctgaagacatccctccttccaaactctctgtggaagtccgg
agtttagagccaggttcgatatacaaatttagggtcattgttatcaaccattacggtgag
agttttcggagctcggcgtcccgtccctaccaggtggctggtttcccaaatcgcttttcc
aatcgccccataactggacctcacatcgcatacacagaggctgtcagcgatactcagatc
atgctaaaatggacgtatattccatcaagtaacaataacactcccattcaaggattctat
atctattaccggccaacagacagtgacaatgacagtgattacaagagggatgttgtggaa
ggttcaaagcagtggcacaccattggtcacctgcagccagagacctcctatgacattaag
atgcagtgctttaatgaaggaggagagagcgagttcagcaacgtgatgatctgcgagact
aaagtgaaacgagttcccggagcatcggagtatcccatgaaagagttgagcactcctccc
agttcttcagggaacggagggaacgtggggcctgcaaccagccctgccaggagcagcgac
atgctgtacctcatcgtcggctgtgtgcttggggttatggtcctcattcttctggtcttc
attgcactgtgtctgtggaagagtcgccaacagagtgccatacagaaatatgatcctcca
ggatatctctaccaggggtcagagattaatgggcagatggtagagtataccactctctca
ggaacagcccggatcaatgggagtgttcacggaggcttcctcagcaaaggcagtctcagc
aatggctgctctcacctccaccacaaaggccccaacggagtcaatgggatcctgaatgga
accataaatggggggctttattctgcacacaccagctccctaaccaggacgtgtgtggag
ttcgaacatcctcaccatctagtgaacggtggagcagtgtacacggctgtccctcagatg
gacccactggaatgcattaattgtcggaattgccggaacaacaataggtgtttcaccaaa
accaacagtccccttcctgtggtcccagtggtagcctcttatcctcaggatggactggaa
atgaagcccctcggtgtcatgaagttcccagtgtgtccagtttccacagttcctgatggt
ggccagatacctgaggagtgcctcaaggacagcgtggcaccagcacctacccagcgtaca
tgccgccaggacaacacaagcgacatcaattctgattccacagaagacacagcagagttc
aacagaggagacagcagcggtcattcagaagcagaggacaaagttttcagttggagtcct
cttattttatcacctgtcttggaggactgcagtgagaagacagcgtggtctcctcctggc
ccccctctagacgggctgtcagtggtccttcagcaagcccaagagacctga

DBGET integrated database retrieval system