KEGG   Rattus norvegicus (rat): 53949Help
Entry
53949             CDS       T01003                                 

Gene name
Chrm5
Definition
(RefSeq) cholinergic receptor, muscarinic 5
  KO
K04133  muscarinic acetylcholine receptor M5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04725  Cholinergic synapse
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    53949 (Chrm5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    53949 (Chrm5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    53949 (Chrm5)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    53949 (Chrm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    53949 (Chrm5)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    53949 (Chrm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 53949
NCBI-ProteinID: NP_059058
RGD: 620027
Ensembl: ENSRNOG00000006397
UniProt: P08911
Position
3q35
AA seq 531 aa AA seqDB search
MEGESYNESTVNGTPVNHQALERHGLWEVITIAVVTAVVSLMTIVGNVLVMISFKVNSQL
KTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWVLGSLACDLWLALDYVASNASVMNL
LVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLVSFILWAPAILCWQYLVGKRTVPPD
ECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVAEAKK
REPAQRTLLRSFFSCPRPSLAQRERNQASWSSSRRSTSTTGKTTQATDLSADWEKAEQVT
TCSSYPSSEDEAKPTTDPVFQMVYKSEAKESPGKESNTQETKETVVNTRTENSDYDTPKY
FLSPAAAHRLKSQKCVAYKFRLVVKADGTQETNNGCRKVKIMPCSFPVSKDPSTKGPDPN
LSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGY
WLCYVNSTINPICYALCNRTFRKTFKLLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggagtcttacaatgaaagcactgtcaacggcaccccggtaaatcaccaggct
ttggaacgccatggactgtgggaagtcattactattgcagttgtgactgcggtggtcagc
ctgatgaccattgtcggcaatgtcttggtcatgatctccttcaaagtcaacagtcagctc
aagacagttaacaactactacctgctcagcttggcctgtgcagacctcatcattggcatc
ttctccatgaacctctacacgacctacatcctcatgggacgctgggttctcgggagtctg
gcttgtgacctttggctggcactcgactatgtagccagcaatgcttctgtcatgaacctt
ctggtgattagttttgatcgttacttttccatcacaagaccactgacgtaccgggccaag
cgtaccccaaagagggctggcatcatgattggcttagcatggctggtctccttcatcctc
tgggcgccagccatcctctgctggcagtacttggtcgggaagcggacagtaccacctgat
gagtgccagatccagttcctctctgaacccaccatcacttttgggactgccattgctgcc
ttctacatccctgtctccgtcatgaccatactctactgccggatctaccgggagacagag
aagcgaaccaaggacctggctgacctccaaggttctgattctgtggcagaagccaagaag
agagagccagctcaaaggaccctgctcagatctttctttagctgccctagacccagcctg
gcccagagagaaaggaatcaggcctcctggtcatcctcccgtagaagcacctcaacaaca
ggaaagacaacccaggccactgacctaagtgctgactgggaaaaggctgagcaggttact
acctgtagcagctacccctcttcagaggatgaagccaagcccaccactgaccctgtcttt
caaatggtctacaagagtgaggccaaggaaagcccggggaaggaatccaatacccaagag
accaaggaaacagttgtgaacacccggactgaaaacagtgactatgacactcccaaatac
tttctgtctccagctgctgctcacagactcaagagtcagaagtgtgttgcctataagttc
cgattggtggtaaaagccgatgggacccaggagactaacaatggctgtcgaaaggtgaaa
atcatgccctgttccttcccagtgtccaaagacccttcaacaaaaggtccggatcccaac
ctcagtcatcaaatgaccaaacgaaagagaatggttctggtcaaagagaggaaagcggct
cagaccttgagtgccattctcctggccttcatcatcacatggaccccttataacatcatg
gtcctggtttccaccttctgtgacaagtgtgtccccgtcaccctgtggcacttgggttac
tggctgtgctatgtcaacagcaccatcaaccccatctgctatgctctctgcaacagaact
ttcaggaaaacctttaagctgcttcttctctgccggtggaaaaagaaaaaagtagaagag
aaattgtattggcaaggaaacagcaagctaccctga

DBGET integrated database retrieval system