KEGG   Rattus norvegicus (rat): 54133
Entry
54133             CDS       T01003                                 

Gene name
Pdlim1
Definition
(RefSeq) PDZ and LIM domain protein 1
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    54133 (Pdlim1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   54133 (Pdlim1)
SSDB
Motif
Pfam: DUF4749 PDZ LIM PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 54133
NCBI-ProteinID: NP_059061
RGD: 68324
Ensembl: ENSRNOG00000016166
UniProt: P52944
Position
1
AA seq 327 aa
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAAIANLCIGDLITAIDGEDTSS
MTHLEAQNKIKGCVDNMTLTVSRSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAH
NRSAMPFTASPAPGTRVITNQYNSPTGLYSSENISNFNNAVESKTSASGEEANSRPSAQP
HPSGGLIIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESDGKGDPNKPSGFRSVKA
PVTKVAASVGNAQKLPICDKCGTGIVGVFVKLRDHHPHPECYVCTDCGINLKQKGHFFVG
DQIYCEKHARERVTPPEGYDVVTVFPK
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccacccagcagattgttctccagggcccgggaccctggggtttccgactcgtgggc
ggcaaggactttgagcaacctctcgccatttcccgggtcactcccgggagcaaggctgct
atagctaacttatgcataggagatttgatcacagccattgatggggaagataccagcagt
atgacacacttggaagctcagaacaaaatcaagggctgcgtagacaacatgacgctcaca
gtatccaggtctgagcagaagatttggtctcctctagtgaccgaggaggggaaacgtcac
ccctacaagatgaatttagcgtcggaaccccaagaagtcctgcacatcggaagtgcccac
aaccgtagtgctatgccatttaccgcctcacctgctcctggcacccgggtcatcacaaac
cagtacaacagccctaccggcctctactcatctgaaaacatctctaacttcaacaatgca
gtggagtcaaagacctcagccagtggggaggaggcgaacagcaggccctcggctcagcct
catccctccggcggccttatcatcgacaaggaatccgaagtttacaagatgcttcaggag
aagcaagagttaaacgagccccccaaacagtccacatcattcctggttctgcaggagatc
ctggagtcggatgggaaaggggaccccaacaagccatcaggatttagaagtgttaaagct
ccagtcaccaaagtggctgcatctgttggaaatgctcagaagctgcccatctgtgacaaa
tgtggaaccggcattgttggtgtgtttgtgaagctgagggaccatcatccccaccctgaa
tgttatgtgtgcaccgactgtggcatcaacctgaaacagaagggccatttctttgtaggg
gatcagatttattgtgaaaagcatgcccgggagagggtcacaccacctgagggctatgat
gtggtcacagtgttccccaagtga

DBGET integrated database retrieval system