KEGG   Rattus norvegicus (rat): 541462
Entry
541462            CDS       T01003                                 

Gene name
Sprn
Definition
(RefSeq) shadow of prion protein homolog (zebrafish)
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Shadoo
Other DBs
NCBI-GeneID: 541462
NCBI-ProteinID: NP_001027015
RGD: 1561845
Ensembl: ENSRNOG00000018927
UniProt: Q5BIV7
Position
1q41
AA seq 147 aa
MNWTTATCWALLLATAFLCDSCSAKGGRGGARGSARGVRGGARGASRVRVRPAPRYSSSL
RVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWT
SGSGSVHSPRICLLLSGTLGALELLRP
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaactggactactgccacatgctgggctctgctgctggccaccgccttcctctgtgac
agctgttcggccaagggcggccgcggaggtgctcgaggcagtgccaggggggtgcgcgga
ggtgcgcgcggggcatcaagagtgcgtgtaaggccggcgccccgctacagctcctctctg
cgagtggcggctgcaggagcagcagctggggctgcggcgggtgtggctgcgggccttgcc
accggctctggctggaggaggacctcaggacctggagagctaggcctggaggacgatgag
aacggggcaatgggaggcaacgggaccgaccgaggagtctacagctactgggcctggact
tccggctcagggtccgtacacagtccacgtatttgcctgcttttgagcggcacgcttggt
gccctagaactgcttcggccctag

DBGET integrated database retrieval system