KEGG   Rattus norvegicus (rat): 54223
Entry
54223             CDS       T01003                                 

Gene name
Adcy4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    54223 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    54223 (Adcy4)
   04371 Apelin signaling pathway
    54223 (Adcy4)
   04020 Calcium signaling pathway
    54223 (Adcy4)
   04072 Phospholipase D signaling pathway
    54223 (Adcy4)
   04024 cAMP signaling pathway
    54223 (Adcy4)
   04022 cGMP-PKG signaling pathway
    54223 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    54223 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    54223 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    54223 (Adcy4)
   04062 Chemokine signaling pathway
    54223 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    54223 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    54223 (Adcy4)
   04912 GnRH signaling pathway
    54223 (Adcy4)
   04913 Ovarian steroidogenesis
    54223 (Adcy4)
   04915 Estrogen signaling pathway
    54223 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    54223 (Adcy4)
   04921 Oxytocin signaling pathway
    54223 (Adcy4)
   04926 Relaxin signaling pathway
    54223 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    54223 (Adcy4)
   04918 Thyroid hormone synthesis
    54223 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    54223 (Adcy4)
   04916 Melanogenesis
    54223 (Adcy4)
   04925 Aldosterone synthesis and secretion
    54223 (Adcy4)
   04927 Cortisol synthesis and secretion
    54223 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    54223 (Adcy4)
   04270 Vascular smooth muscle contraction
    54223 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    54223 (Adcy4)
   04971 Gastric acid secretion
    54223 (Adcy4)
   04972 Pancreatic secretion
    54223 (Adcy4)
   04976 Bile secretion
    54223 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    54223 (Adcy4)
   04727 GABAergic synapse
    54223 (Adcy4)
   04725 Cholinergic synapse
    54223 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    54223 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    54223 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    54223 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    54223 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    54223 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    54223 (Adcy4)
   04714 Thermogenesis
    54223 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54223 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    54223 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    54223 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    54223 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    54223 (Adcy4)
   05163 Human cytomegalovirus infection
    54223 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    54223 (Adcy4)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     54223 (Adcy4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 54223
NCBI-ProteinID: NP_062158
RGD: 2034
Ensembl: ENSRNOG00000020401
UniProt: Q66HK5
Position
15p13
AA seq 1072 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLILLLVIVLCAIVALPAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQQLQRWTRPLSGLIWAALLALGYGFLFTGGVVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAAAGVISSLSHLLVLGLYLGWRPESQRDLLPQLAANAVL
FLCGNVVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQSSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRVATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVERADMEHRDPYLRELGEPTYLVIDPWAEEEDEKGTERGLLSSLEGHTMRPSLLMTR
YLESWGAAKPFAHLSHVDSPASTSTPLPEKAFSPQWSLDRSRTPRGLHDELDTGDAKFFQ
VIEQLNSQKQWKQSKDFNLLTLYFREKEMEKQYRLSALPAFKYYAACTFLVFLSNFTIQM
LVTTRPPALATTYSITFLLFLLLLFVCFSEHLTKCVQKGPKMLHWLPALSVLVATRPGLR
VALGTATILLVFTMAVVSLLFLPVSSDCPFLAPNVSSVAFNTSWELPASLPLISIPYSMH
CCVLGFLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLIARLYQGSLGSRPG
VLKEPKLMGAIYFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLE
NVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASIPDFKEFYSESNINHEGLECLRLLN
EIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATPGQDTQQDAERSCSHLGTMVEFA
VALGSKLGVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVL
GKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGSPSAS
NT seq 3219 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggcctcctcccagcgaagatctcttctacgagacttac
tacagcctgagccaacagtatccactgctaattctgcttctggtcattgtgctctgcgcg
atcgtggcactgcccgccgtcgcctgggccagcggcagggagctgacctcagacccaagc
ttcctgacaactgtgctgtgtgctttgggtggcttctccctgcttttggggctcgcttcc
cgggagcagcaactgcagcgatggacacgacctctttctggcctcatatgggctgcattg
ctggctctgggctatgggtttctattcactgggggtgtggtgagcgcctgggatcaggtg
tcctttttcctcttcatcattttcaccgtgtacgccatgctgcccttgggcatgcgggat
gctgctgccgcgggggtcatctcatccctctcacacctgctggtccttggactgtacctt
gggtggcggcctgagtcgcagagggatctgctaccacagttggcagcgaatgcggtgttg
ttcctgtgtgggaacgtggtgggagcataccacaaggccctgatggagcgagcattgcgc
gccacgttccgggaggctcttagctccctgcattcacgccggaggttggacactgagaaa
aagcaccaggagcacctcctcttgtctatccttcctgcctacctggcccgagagatgaag
gcagagatcatggctcggctgcaggctggacagagctcacggccagagaacacaaacaac
tttcacagcctgtatgtcaagaggcaccaaggagtgagtgtgctgtatgctgacatcgtg
ggcttcacacggctggccagtgagtgttcccctaaggagctggtgctaatgctcaatgaa
ctcttcggcaaattcgaccaaattgcaaaggagcacgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtatccgggctgcccctctctctgcctgaccacgccatcaat
tgcgtgcgcatgggactggacatgtgccgggccatcaggaaacttcgggtagccaccggt
gtggatatcaacatgcgtgtcggtgtgcactcaggcagcgtcctctgtggagtcatcggg
ctacagaagtggcagtatgatgtctggtcccatgatgtcacattggccaaccatatggaa
gcaggcggcgttccaggacgagtgcacatcacaggggccacgctggccctgctggcagga
gcttatgctgtggagagagcagacatggagcatcgagacccataccttcgggagctaggg
gaacccacatacctggtcattgatccttgggctgaggaggaagacgagaagggcaccgag
agaggattgctgtcttctctagaggggcacacgatgcgtccgtcactactgatgactcgt
tatctggagtcttggggtgcagccaagcctttcgcccacctaagccacgtcgacagtcct
gcatccacatccactccactcccggagaaagccttcagcccccagtggagcctggaccgg
agtcgcaccccccgcgggctacacgatgaactggacactggagatgccaagttcttccag
gtcatcgaacaactcaactctcaaaaacagtggaaacagtcgaaggacttcaacctcctg
acgctctacttcagagagaaggagatggagaaacagtatcggctgtctgcgctccccgcc
ttcaaatactacgcagcctgcaccttcctggtttttctgtccaacttcacaatccaaatg
ctggtgacaaccaggcccccagctctggccaccacctacagcatcaccttccttctcttc
cttctcctcctcttcgtctgcttctcagagcacctgacgaagtgcgtccagaaaggcccc
aagatgttgcactggctgcctgcgctgtctgtcctggtggccacacggccgggattgcga
gtagccctgggcacagccaccatcctcctggtgttcactatggccgtcgtcagcctgctc
ttcttaccagtgtcgtcagactgccctttcctggctcccaatgtgtcgtcagtggctttt
aatacttcctgggagctgccagcatccctgcctctcatcagcatcccatactccatgcat
tgttgcgtgctgggtttcctttcctgctccctttttctgcacatgagcttcgaactgaag
ctgcttctgcttctgctgtggctggtggcatcttgttccctatttctgcactcccacgcc
tggctgtccgactgcctcattgcccgcctttatcaaggctcattgggctccaggccgggg
gtactgaaggaaccgaaactgatgggagctatctacttcttcatcttcttcttcacactc
ctcgtcctggctcggcagaatgagtattactgtcgcctggacttcctatggaaaaagaaa
ctgaggcaggagcgagaggaaactgagacaatggagaacctgacccggctcctcctggag
aatgtactccctgcacacgtggcgccccagttcatcggccagaaccggcgcaatgaggac
ctctaccatcagtcgtacgaatgtgtttgtgtcctctttgcatccatcccagactttaag
gaattctactcggaatccaacatcaaccatgaggggctagagtgtctgcggctgctcaat
gagatcattgccgactttgatgagctgctctccaagccaaagttcagtggagtagagaag
atcaaaactatcggcagcacctacatggcggccacaggcctaaatgccacccctgggcag
gacacacaacaggacgctgagagaagctgcagccatctgggcaccatggtggaatttgca
gtggccctggggtctaagctgggtgtcatcaataagcactcgttcaacaacttccgcctg
cgtgtggggttaaaccatggaccagtcgtagcaggggtgattggggcgcagaagccacaa
tatgacatctgggggaatacagtgaacgtggccagccgcatggagagcacaggagttctc
ggcaagatccaagtgaccgaggagacagctagggctctgcaatccctgggttacacatgc
tacagccgaggtgtcatcaaggtcaagggcaaagggcaactctgtacctacttcctgaac
acagacctgacacgaaccggatctccctcagcatcctag

DBGET integrated database retrieval system