KEGG   Rattus norvegicus (rat): 54225
Entry
54225             CDS       T01003                                 

Gene name
Apob
Definition
(RefSeq) apolipoprotein B-100 precursor
  KO
K14462  apolipoprotein B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04975  Fat digestion and absorption
rno04977  Vitamin digestion and absorption
rno04979  Cholesterol metabolism
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    54225 (Apob)
   04979 Cholesterol metabolism
    54225 (Apob)
   04977 Vitamin digestion and absorption
    54225 (Apob)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    54225 (Apob)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    54225 (Apob)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    54225 (Apob)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   54225 (Apob)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   54225 (Apob)
SSDB
Motif
Pfam: Vitellogenin_N DUF1943 DUF1081 ApoB100_C DUF1451 PH_RBD
Other DBs
NCBI-GeneID: 54225
NCBI-ProteinID: NP_062160
RGD: 2129
Ensembl: ENSRNOG00000005542
UniProt: Q7TMA5 F1M6Z1 Q4G047
Position
6
AA seq 4506 aa
MGPQRPALRAPLLLLFLLLFLDTSVWAQDEVLENFILNCPKDATRFKHLRKYVYSYEAES
SSGVRGTADSRSATKINCKVELEVPQVCTLIMRTSQCTLKEVYGFNPEGKALMKKTKNSE
EFASAMSRYELKLAFPEGKRVALYPDLGEPNYILNIKRGIISALLVPPETEEDKQVLFQD
TVYGNCSTQVTVNSRKGTVATEMSTERNLQHCDGFQPISTSVSPLALIKGLVRPLSTLIS
SSQSCQYTLEPKRKHVSEAICNEQHLFLPFSYKNKYGIMTHVTQKLSLEDTPKINSRFFR
GGINQVGLAFESTKSTSPPKQADAVLKTLQELKKLSISEQNAQRANLFHKLVTELRGLSG
EAITSLLPQLIEVSSPITLQALIQCGQPECYTHILQWLKTEKAHPLLIDIVTYLMALIPN
PSVQRLQEIFNTAKELQSRATLYALSHAVNSYYAIMDHSRSPVLEDIAGYLMKQIDNECM
GDEDRTFLILRVIGNMGRTMERVMPALKSSVLNCVRSTKPSLQIQKAALQALRKMEMGDE
VRTILFDTFVNDVAPVEKRLAAYLLLMRSPSSSDINKIAKLLQWEQSEQVKNFVASHIAN
ILNSEELYVQDLKNLIKNALVNSRLPTIMDFRKFSRNYQISKSVSIPLFDPVSAKIEGNL
VFDPSSYLPKESMLKTTLTVFGIASLDLFEIGLEGKGFEPTLEALFGKQGFFPDSVNKAL
YWVNGQVPDRVSKVLVDHFGYTKDDKHEQDMVNGIMPIVDKLIKELKSKEIPEARAYLRI
LGKELGFVRLQDLQVLGKLLLNGAQTFRGVPQMIVQAIREGSKDDLFLHYIFMENAFELP
TGVGLQLQVSSSGVFTPGIKAGVRLELANIQAELVAKPSVSLEFVTNMGIIIPDFAKSGV
QMNTNFFHESGLEARVALKAGQLKVIIPSPKRPVKLFSGSNTLHLVSTTKTEVIPPLIEN
RKSWSTCKPFFTGMNYCTTGAYSNASSTESASYYPLTGDTRYELELKPTGEVEQYSASAT
YELLKEDKSLVDTLKFLVQAEGVQQSEATAMFKYNRRSRTLSSEVLIPGFDVNFGTILRV
NDESSKDKNTYKLILDIQNKKITEVSVVGHVSYDKKGDGKVKGVVSIPRLQAEARSEVHT
HWSPTKLLFQMDSSATAYGSTISKRVAWRYDNEKIEFDWNTGTNVDTKKVASNFPVDLSR
YPRMVHEYANGLLDHRVPQTDMTFRHMGSKLIVATNTWLQMATRGLPYPQSLQDHLNGLS
ELNLPKVGLPDFHIPDNLFLKTDGRVKYTLNKNRIEIDIPLPLGGKSSKDLKVPESVRTP
ALNFKSVGFHLPSQEVQIPTFTIPKTHQLQVPLLGILDLSTNVYSNLYNWSVSYTGGNTS
RDHFSLQAQYRMKADSVVDLFSYSVQGSGETTYDSKSTFTLSCDGSLHHKFLDSKFKVSH
VEKFGNNPVSKGLLTFETSSALGPQMSATVQLDSKKKQHLYVKDIKVDGQFRVFSLYAQG
EYGLSYERDSMTGQMSGESNMKFNSTYFQGTNQIVGMYQDGMLSVTSTSDLQDGIFKNTA
SLKYENYELTLKSDSSGQYENFAASNKLDMTFSKQSALLRSEHQANYKSLRLVTLLSGSL
TSQGVELNADILGTDKINTGAHKSTLKIAQDGVSTSATTNLKYSPLLLENELNAELGLSG
ASMKLSTSGRFKEHHAKFSLDGRAALTEVSLGSIYQAMILGADSKNVFNFKLSREGLKLS
NDMMGSYAEMKLDHTHSLRISGLSLDFFSKMDNIYSGDKFYKQNFNLQLQPYSFGITLSN
DLKYDALVLTNNGRLRLEPLKLNVGGNFKGTYQNNELKHIYTISYTDLVVASYRADTVAT
VQGVEFSHRLNADIEGLASSVDVTTSYSSDPLHFNNVFRFVLAPFTLGVDTHTSGDGKMS
LWGEHTGQMYSKFLLKAEPLALTFSHDYKGSTSHNLLYKNSVSTALEHTLSALLTPAEQT
SSWKFKTSLNDKVYSQEFEAYNTKDKIGIELSGRADLSGLYSPIKVPFFYSEPVNVLNSL
EINDAFDEPREFTIDAVVKYDKNQDVHTISLPFFQSLPDYLERNRRGIISLLEAMKGELQ
RLSVDQFVRKYRVALSRLPQQIHDYLNASDWERQVAGAKEKLTSFMENYRITDNDVLIAL
DSAKINLNEKLSQLETYAIQFDQYIRDNYDAQDLKRTIAQIIDRIIEKLKMLDEQYHIRV
NLAKSIHNLYLFVENVDLNQISSSGASWIQNVDTKYQIRIQIQEKLQHLRTQIHNIDIQQ
LAAELKQQIEALDVPMHLDQLRTAILFQRISVIIERVKYFVMNLIEDFKVTEKINTFRVI
VRELIEKYEVDRQIQVLMDKSIELAHRYSLSEPLQKLSNVLQQIEIKDYYDKLVGFIDDT
VEWIKAVSFKNIIEELNRLIDMSVKKLKAFDYHQFVDKTNSKIREMTQRINAEIQALELP
QKTEALKLWVEDFKTTVSNSLEKLKDTKVTVVVDWLQDGLAQIKAQFQDALEDVRDRIYQ
MDIQGELERCLSLVSQVYSTVVTYISDWWTLTAKNITDFAEQYSTQKWAESVKALVEQGF
IVPEIQTFLGTMPAFEVSLHALQEANFQTPDFIVPLTDLRIPSIWINFKMLKNVKIPLRF
STPEFTLLNTFRVRSFTIDLLEIKAKIIRTIDQMLSSELQWPLPEVYLRDLEMVNISLAR
LSLPDFHVPEITIPEFTIPNVNLKDLQVPDLHIPEFQLPHLSCTTEIPAFGKLHSVLKIQ
SPLFILDASANIQNITTSENKAEIVASVTARGESKFEALNFDFQAQAQFLELNANPLVLK
ESVNFSSKHVRMEHEGKILVSGKALEGKSDTVARLHTEKNTVEFNNGIVVKINNQFTLDS
QTKYFHKLSVPRLDFSSKASLNNEIKTLLEAGHMAWTSSGTGSWNWACPNFSDEGIHSSK
ISFIVDGPIASFGLSNNINGKHLRVVQKLTSESGFLNYSRFEVESKVESQHVGSSILTAE
GRALLGDAKAEMTGEHNANLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVSFPLKLT
GKIDFLNNYALFLSPHAQQASWQLSTRFNQYKYNQNFSAINNEHNMEASIVMNGDANLDF
LNIPLTIPEINLPYTRFTTPLLKDFSIWEETGLKEFLKTTKQSFDLSIKAQYKKNRDKHS
VVIPLKMFYEFMLNNVNSWDRKFEKVRDNALHFLTASYNETKIKFDKYKTENSLNQPSRT
FQNRGHTIPVLNIEVSPFAVETLASSHVIPKAIRTPSVTIPGPNIIVPSYRLVLPSLQLP
VFHIPRTLFKFSLPDFKKLSTIDNIYIPAMGNFTYDFSFKSSVITLNTNAGLYNQSDLVA
RFLSSSSFVTDALQYKLEGTSRLMRKKVLKLATAVSLTNKFLKGSHDSTISLTKKNMEAS
VKTTANLHAPIFTMNFKQELNGNTKSKPTVSSSIELNYDFNSSKLHSAAKGGVDHKFSLE
SLTSYLSIESFTKGNIKGSFLSQEYSGSVANEANVYLNSKGTRSSVRLQGASNFAGIWNF
EVGENFAGEATLRRIYGTWEHNMINHLQVFSYFDTKGKQTCRATLELSPWTMSTLLQVHV
SQPSPLFDLHHFDQEVILKASTKNQKVSWKSEVQVESQVLQHNAHFSNDQEEVRLDIAGS
LEGQLWDLENFFLPAFGKSLRELLQIDGKRQYLQASTSLHYTKNPNGYLLSLPVQELTDR
FIIPGLKLNDFSGIKIYKKLSTSPFALNLTMLPKVKFPGVDLLTQYSKPEGSSVPTFETT
IPEIQLTVSQFTLPKSFPVGNTVFDLNKLTNLIADVDLPSITLPEQTIEIPSLEFSVPAG
IFIPFFGELTAHVGMASPLYNVTWSTGWKNKADHVETFLDSTCSSTLQFLEYALKVVGTH
RIENDKFIYKIKGTLQHCDFNVKYNEDGIFEGLWDLEGEAHLDITSPALTDFHLHYKEDK
TSVSASAASPAIGTVSLDASTDDQSVRLNVYFRPQSPPDNKLSIFKMEWRDKESDGETYI
KINWEEEAAFRLLDSLKSNVPKASEAVYDYVKKYHLGHASSELRKSLQNDAEHAIRMVDE
MNVNAQRVTRDTYQSLYKKMLAQESQSIPEKLKKMVLGSLVRITQKYHMAVTWLMDSVIH
FLKFNRVQFPGNAGTYTVDELYTIAMRETKKLLSQLFNGLGHLFSYVQDQVEKSRVINDI
TFKCPFSPTPCKLKDVLLIFREDLNILSNLGQQDINFTTILSDFQSFLERLLDIIEEKIE
CLKNNESTCVPDHINMFFKTHIPFAFKSLRENIYSVFSEFNDFVQSILQEGSYKLQQVHQ
YMKAFREEYFDPSVVGWTVKYYEIEEKMVDLIKTLLAPLRDFYSEYSVTAADFASKMSTQ
VEQFVSRDIREYLSMLADINGKGREKVAELSIVVKERIKSWSTAVAEITSDYLRQLHSKL
QDFSDQLSGYYEKFVAESTRLIDLSIQNYHMFLRYIAELLKKLQVATANNVSPYLRFAQG
ELIITF
NT seq 13521 nt   +upstreamnt  +downstreamnt
atgggcccacagaggcctgccctgcgggcaccgctactgctgctgttcctgcttctgttc
ttggacaccagcgtctgggctcaagatgaagtcctagaaaacttcatcttgaactgtcca
aaagatgcaactcgattcaagcacctccggaagtacgtgtacagctatgaggctgaaagt
tccagcggtgtccggggcactgctgactccagaagcgccaccaagattaactgcaaggtg
gagctggaggtcccccaagtctgcactctcatcatgaggaccagccagtgtacccttaaa
gaggtgtatggcttcaaccctgagggcaaagccttgatgaagaaaaccaagaactctgaa
gagtttgcatctgccatgtccaggtacgagctcaagctggcctttcctgaagggaaacga
gttgctctttaccctgacctgggtgaacctaactatatcctgaacatcaagaggggcatc
atctctgctcttctggttcccccagagacagaagaggacaaacaagttttgttccaggat
acagtctatggaaactgctcaactcaggttacagtgaattcaagaaaggggaccgtggcg
acagaaatgtccacagagagaaacctgcagcattgtgatggcttccagcccatcagcaca
agtgtcagccctctggctctcatcaaaggcctggtccgccccttgtcaactctaatcagc
agcagccaatcttgccagtacactctggagcccaagaggaagcatgtgtctgaagccatc
tgtaatgaacagcatcttttcctgcctttctcctacaagaataagtatggaatcatgacc
catgttacacagaaactgagtcttgaagatacacctaagatcaacagtcgcttcttcaga
ggaggtatcaaccaagtgggtctggctttcgagagcaccaagtccacatcacccccaaag
caggctgatgctgttttgaagacccttcaagaactgaaaaaattgtccatctcagagcag
aatgctcagagagcaaatctcttccataaactggttactgagctgagaggtctcagtggt
gaagcgatcacatccctcttgccacagctgatcgaagtgtccagccccatcactttacaa
gccttgattcagtgtggacagccggagtgctatactcacatcctccagtggctgaaaact
gagaaggctcaccccctcctgattgacattgttacctacctgatggctctgatcccaaat
ccctcagtgcagaggctgcaggagatctttaatactgccaaggaactgcagagccgagcc
accctgtatgcactgagccatgcggttaacagctattatgctattatggaccattcaagg
agcccagttctggaagatattgctggttacctgatgaagcagattgataatgaatgcatg
ggggatgaagaccgcaccttcttgattctgagggtcattggtaatatgggcagaaccatg
gaacgagtgatgccagcactcaagtcctcagtcctcaactgtgtgagaagcacaaaacca
tctctgcagattcagaaagctgctctccaggccctgaggaagatggagatgggagatgag
gtccgaacgatcctttttgatacgtttgtgaatgatgttgccccagtggagaagagactg
gctgcctatctcttgttgatgaggagcccttcctcatcagatattaacaaaattgccaag
cttctccaatgggaacagagtgaacaggtgaagaacttcgtggcttctcacattgccaac
atcttgaactcagaagaactttatgtccaagatctgaaaaatctgatcaaaaatgctctg
gtgaattctcgacttccaacgatcatggacttcagaaaattttcccgaaactatcaaatt
tccaaatctgtttctattccactgtttgacccagtctcagccaaaatcgaagggaatctt
gtatttgatccaagcagttatcttcccaaagaaagcatgctgaaaacaaccctcacggtc
tttggaattgcttcacttgatctctttgagattggtttagaaggaaagggctttgagcca
acactggaagctctttttggtaagcaaggattcttcccagacagtgtcaacaaggctttg
tattgggtcaatggtcaagttccagatcgtgtctccaaggtcttggtagaccactttggc
tacactaaggatgacaaacatgaacaggacatggtgaatggaatcatgcccattgtggac
aagttgatcaaagaactgaaatctaaagaaattcctgaagccagggcctatctccgcatc
ctaggaaaagagcttggctttgtcaggctccaagacctccaagtcctgggaaagttactg
ctgaatggtgcgcaaacttttcggggagtgccccagatgattgtacaggccatcagagaa
ggatcaaaggatgacttgtttctccactacatcttcatggagaatgcctttgagctcccc
actggagtagggctacagctgcaagtgtcctcatctggagtcttcacccctgggatcaag
gctggtgtgagactggagttagccaatattcaggcagagctagtggcaaagccctctgtg
tctttggagtttgtgacaaatatgggcatcatcatcccagacttcgctaagagcggtgtt
cagatgaatacaaacttcttccacgagtcaggcctggaggctcgagtggccctgaaggct
gggcagctgaaggtcatcattccttctccgaagaggccggtcaagctgttcagtggcagc
aacacgctgcacctggtctctaccaccaaaacggaagtgatcccacctttgattgagaac
aggaagtcctggtcaacttgcaagcctttcttcaccggcatgaactactgtaccacaggg
gcttactccaatgccagctccacagagtctgcctcttactacccactgacaggagacaca
aggtatgagctggagttgaagcccacaggagaggtggagcagtattccgccagtgcaacc
tatgagctcctaaaagaggacaagtctttggttgacacactgaagttcctagtgcaagca
gaaggagtccagcagtctgaagctactgcaatgttcaaatataatcggcgaagcaggacc
ttatctagtgaagtcctaataccagggtttgatgtcaactttggaacaatcctcagagtt
aatgatgaatcttctaaggacaaaaacacttacaaactcatcctggacattcagaacaag
aaaatcactgaggtttctgtcgtgggccacgtgagttatgacaaaaagggagatggcaag
gtcaaaggtgttgtttccataccacgtttgcaagcagaagccaggagtgaggttcatacc
cactggtcccccaccaaactgctcttccaaatggactcatctgctacagcttacggctca
acaatttccaagagagttgcatggcgttatgataatgagaaaatcgaatttgattggaac
acgggcaccaatgtggataccaaaaaggtggcctccaatttccctgtggatctttcccgt
tatcctagaatggtgcatgagtatgccaatggtctcctggatcacagagtccctcagaca
gatatgactttccgacacatgggttccaaactaattgttgcaacaaacacatggcttcag
atggcaaccaggggtcttccttacccccaatctctacaggatcacctcaatggcctctca
gagttgaacctcccaaaagtgggattgccagacttccatatcccagacaacctcttccta
aaaactgatggccgagtcaaatacacactaaacaagaacagaatagagattgacattcct
ttgcctttgggtggcaagtcttcaaaagacctcaaggtgccagaaagtgtgaggacacca
gccctcaacttcaagtctgtggggttccatctgccgtctcaagaggtccagattcccact
tttacaatccccaagacacatcagctgcaagtgcctctcttgggcattctggacctttcc
acaaatgtctacagcaacttgtacaactggtcagtctcctacactggtggcaacaccagc
agggatcacttcagccttcaggctcagtaccgcatgaaggctgactctgtggttgacctg
ttttcctacagtgtgcaaggatctggagaaacaacatacgacagcaagagcacattcact
ttatcgtgtgatgggtctctacatcataaatttctagattccaaattcaaagtcagccac
gtagaaaaatttggaaacaacccagtctcgaaaggtttattaacatttgaaacatctagt
gccttgggaccacagatgtctgctacagttcagctggactcaaaaaagaaacaacatctg
tatgtcaaagacatcaaggttgacggacagttcagagtattttcattgtacgctcaaggt
gaatatggcctgtcttatgagagagattctatgactggccagatgagcggagaatccaac
atgaaatttaactccacctacttccagggcaccaaccagatagtgggaatgtaccaggat
ggaatgctgtctgtcacttccacctctgacctgcaagatggcatattcaagaacacagct
tccctaaaatatgaaaactatgagttgactctgaaatccgacagcagtgggcagtatgag
aactttgctgcttccaacaagctggacatgaccttctctaagcaaagcgcactgctgcgt
tctgaacaccaggccaactacaagtccctgagacttgtcacccttctttctggatccctc
acttcccagggtgtagaattaaatgctgacatcttgggcaccgacaaaattaatactggt
gctcacaagtcaacgctaaagattgcacaagatggagtatctaccagtgcaaccaccaac
ttaaagtacagcccgctgctgctggagaatgagttgaacgcagagcttgggctctctggg
gcatccatgaaattgtcaacaagtggccgcttcaaagaacaccatgcaaaattcagtctt
gatgggagagctgccctcacagaggtatcactgggaagcatttaccaggccatgattctg
ggtgcagacagcaaaaatgtcttcaacttcaaactcagccgagaaggactgaagctatcc
aatgacatgatgggctcctacgctgaaatgaaactcgaccacacacacagtctgagaatt
tcaggtctctccctggacttcttctcaaaaatggacaatatttacagtggagacaagttt
tataagcagaattttaacttacagctacagccctattcttttggaattactttaagcaat
gatctgaaatatgatgctctagttttgaccaacaatggaaggttacggctggaaccactg
aagctgaatgtgggtggcaactttaagggaacctaccaaaataatgagctgaaacacatc
tataccatctcttatactgacctggtagtagcaagttacagagcagacactgtagctacg
gttcagggtgtggagttcagccataggctaaatgcagacatcgaagggctggcttcctcc
gttgatgtcactaccagctacagttcagatccactgcattttaacaatgttttccgcttt
gttctggcaccgtttaccttgggcgtcgacacacatacaagtggtgatgggaaaatgtcc
ctctggggagaacacactgggcagatgtacagtaaatttctgttgaaagcagaacctctg
gcacttaccttctctcatgactacaaaggatccacgagccacaatctcctgtacaagaac
agcgtcagtacagctcttgagcacacactcagtgccttgctgactccagctgaacagaca
agcagctggaaattcaagaccagcctgaatgacaaagtatacagccaggaatttgaagcc
tacaacactaaagacaaaattggtatcgagcttagtggacgggctgacctctctgggctg
tactctccaattaaagtgccgtttttctacagtgagcctgtcaatgttcttaatagcttg
gagataaatgatgcctttgacgagccccgagaattcacaattgatgctgtggtgaaatac
gataagaaccaagatgtccacactatcagcctcccattcttccaaagcctgccagattat
ttggagagaaatcgaagaggaattataagtctactggaagccatgaagggggaattacaa
cgcctcagtgttgatcagtttgtgaggaaatatagagtggccctgagcaggcttcctcag
cagattcatgattatctgaatgcatctgactgggagagacaagtagctggtgccaaggaa
aaattaacttctttcatggaaaactatagaattacagataatgatgtactaattgcctta
gatagtgccaaaatcaacttgaatgaaaaactctctcaacttgagacatacgcgatacaa
tttgatcagtatattagagataattatgatgcacaggacttaaaaagaactattgctcag
attattgatagaatcattgaaaagctaaaaatgcttgacgaacagtatcatatccgtgta
aatctagcaaaatcaatccataatctctatttatttgttgaaaatgttgatcttaaccaa
atcagtagtagtggtgcgtcttggatccaaaatgtggataccaaatatcaaatcagaatc
cagatacaagaaaaactccagcatctcagaacacagattcataatatagacattcaacag
cttgctgcagagttaaaacaacagattgaagctcttgatgtcccaatgcatttagatcaa
ctgagaactgcaattctattccaaagaataagtgtcattattgagcgtgtcaaatacttt
gttatgaatcttattgaagattttaaagtaactgagaaaatcaatacttttagagttata
gtccgtgagttaattgagaaatatgaagtagaccgacaaatccaggttttaatggataaa
tcaatagagttggcccacagatacagcctgagtgagcctcttcagaaactaagtaatgtg
ctacagcaaattgagataaaagactactatgataaattggttggttttattgatgacact
gtcgagtggattaaagcagtgtctttcaaaaatatcattgaagaactgaatagattgatt
gacatgtcggtgaaaaagttgaaagcctttgattatcaccagtttgtagacaaaaccaac
agcaaaatccgtgagatgactcagagaatcaatgctgaaatccaagctctcgaactccca
cagaaaactgaagcattaaaactgtgggtagaagacttcaaaaccacggtctccaactcc
ctggaaaaactcaaggacaccaaagtaactgtggtcgttgattggctgcaggatggtttg
gctcaaataaaagcccaattccaagatgctttagaagatgtacgagaccgaatttatcaa
atggacattcagggggaactggagcgctgcttgtctctggtaagccaagtttacagcaca
gtggtcacctacatttctgactggtggactctgactgctaaaaacataacagactttgca
gagcaatattccacccaaaagtgggctgagagtgtgaaagcactggtggaacaaggattc
attgttcctgaaatccaaacatttctggggaccatgcctgcatttgaggtcagtctccac
gctctccaagaagctaactttcagactcctgactttatagtccccttgacagatttgagg
attccatcaatttggataaacttcaaaatgttaaagaatgtaaaaatcccattgagattt
tccactccagaattcactctcctcaacaccttccgtgtccgttcctttacaattgacttg
ctggaaataaaagcaaagatcattcgaactatcgaccaaatgctgagcagtgagctacag
tggcctcttccagaagtgtatttgagagacctggagatggtgaacatttctcttgcaaga
ctctctctgccagacttccatgtaccagaaatcacaattccagaattcacaatcccaaat
gtcaatctcaaagatttacaggttcctgatcttcacataccagaattccagcttcctcac
ctctcatgcacaactgaaatacctgctttcggcaaactacatagcgtcctgaaaatccaa
tctcccctctttatattagatgctagtgccaacatacagaacataactacttcagagaac
aaagcagagattgtggcttctgtcactgccagaggagagtccaaatttgaagctctcaat
tttgattttcaagcacaagctcagttcctggagttaaatgctaatcctctggtactgaag
gaatccgtgaacttctccagtaaacatgtgagaatggagcatgagggtaagatattagtt
tctggaaaagcccttgagggaaaatcagacacggttgcaagattacacacagagaaaaat
acagtggagtttaataatggtattgttgtcaagataaacaatcaattcacccttgacagt
caaacaaagtacttccacaagttgagtgtccccaggctggacttctccagtaaggcttct
ctcaacaatgaaatcaagacactattagaagctggacatatggcatggacttcttcaggg
acagggtcatggaactgggcctgtcccaacttctcagatgaaggcatacattcatccaaa
attagcttcattgtggatggccccattgcttcttttggattgtccaataacataaatggc
aaacacctaagggttgtccaaaaactgacttctgaatctggcttcctcaactattctagg
tttgaagttgagtcaaaagttgaatctcagcacgtgggctccagcattctaactgccgag
ggtcgggcactgcttggggatgcaaaggcagaaatgactggtgagcacaatgccaactta
aatggaaaagttattggaacgttgaaaaattctcttttcttttcggcacaaccatttgag
attactgcatccacaaataatgaagggaatttgaaagttagttttccactaaagttgact
gggaaaatagacttcctaaataactatgcactgtttctgagcccccatgcccaacaagca
agctggcaattgagtactagattcaatcagtacaaatacaatcaaaatttttcggctata
aacaatgagcacaacatggaagccagtatagtaatgaatggagatgccaaccttgatttc
ttaaacatacctttaacaattcctgaaattaatctaccttacacaaggttcacaactccc
ttactgaaggatttctccatatgggaagaaacgggcttgaaagaatttttgaagacaaca
aagcagtcatttgacttgagtataaaggctcaatataaaaagaacagagacaagcattct
gttgttatccctctgaaaatgttttatgagtttatgctcaacaatgtcaattcttgggac
agaaaatttgagaaagtcagagacaatgcattacattttcttaccgcatcctataatgaa
acaaaaattaagtttgataagtacaaaactgaaaattccctcaatcagccttccaggacc
tttcaaaatcgtggacacactatcccagttctcaacattgaagtgtctccatttgctgta
gagacactggcttccagccatgtgatcccgaaagcaatccgcaccccaagcgtcacaatt
ccaggtcctaacatcattgtgccttcatacaggttagtgctgccgtctctacagttgcca
gttttccatatccctaggactctattcaagttttccctcccagatttcaagaaattaagc
actattgacaatatttatattccagccatgggcaatttcacctatgacttttcttttaaa
tcaagtgtcatcacactgaataccaatgctggactttataaccaatcagatctcgttgct
cgttttctttcttcctcttcatttgtcacggatgccctgcagtacaaactagagggtaca
tcacgtctgatgcggaaaaaagtattgaagttagccaccgctgtctctctaactaacaaa
tttttaaagggaagtcatgacagcaccattagcttaaccaagaaaaacatggaagcttca
gtgaaaacaactgccaacctccacgctcccattttcacaatgaacttcaagcaggaactt
aacggaaacaccaagtcaaagcccactgtctcatcctccattgaactaaactatgacttc
aattcctcaaagctgcactctgcagcaaaaggaggtgttgatcacaagttcagcttagaa
agtctcacttcctacctttccattgagtcattcaccaaaggaaatatcaagggttcgttc
ctttcacaggaatattcaggaagtgtcgccaatgaggcgaatgtgtacctgaattctaag
ggtactcggtcttcagtaaggttacaaggagcctctaattttgctgggatctggaacttt
gaagtaggagaaaattttgctggagaagctactctccgacgcatctatggcacatgggaa
cacaatatgataaaccatttacaggtattcagctactttgacacaaaaggaaaacaaaca
tgcagagccaccctagagctctccccatggaccatgtcaacccttctacaggttcatgtg
agtcaacccagtcccctctttgatctccatcactttgaccaggaagtgatcctgaaagct
agcactaagaaccagaaggtcagctggaaaagtgaggtccaggttgaatcacaggttctt
cagcacaatgcacacttctccaatgaccaagaagaagtacgccttgacattgctggatcc
ttagaaggacagctgtgggaccttgaaaatttctttctaccggcatttggcaagagcttg
agggaactcctacagatagacggaaagcgtcagtatcttcaagcttcgacttctcttcac
tataccaaaaacccgaatggctatctcctctcactccctgtgcaagaactgactgataga
ttcattataccagggctgaaactaaatgacttcagtggaatcaaaatctataagaaatta
agtacttcaccatttgccctcaacctaacaatgctccccaaagtaaaattccctggggtt
gatctgttaacacaatactctaaaccagagggctcctctgtccctacctttgagacaact
atacctgaaattcaattaactgtgtcccagtttacacttccaaagagctttcccgttggc
aacactgtctttgatctgaataagctaaccaacctaattgcagatgttgatctgcctagt
atcaccctgccagagcagaccattgagatcccatcccttgagttctctgtacctgctggg
atttttattccgttctttggagaactgactgcacacgttgggatggcctctcccctgtat
aatgtcacgtggagcactggttggaaaaacaaagcagaccatgttgaaacattcctggat
tccacatgcagttcaaccttgcagtttctggagtatgctctaaaagttgtgggaacacac
aggattgaaaatgataagttcatctataaaatcaaaggaacacttcaacactgtgacttc
aatgtgaagtataacgaagatggtatatttgaaggactttgggacttggagggagaggct
catctggacatcaccagcccagcactgactgacttccatctgcactacaaagaagacaag
acaagtgtgtctgcctcagcagcctccccagccataggcactgtgagtctggatgcaagc
acagatgaccagagtgtgaggctgaatgtctacttccgccctcagtcccctccagataat
aaactcagcatattcaaaatggagtggagggacaaggagtctgatggtgaaacatacatc
aaaattaactgggaagaagaagcagctttcagattgctagactccctaaaaagcaatgtg
cccaaggcttctgaggctgtttatgattatgtcaagaagtaccacctgggacatgcttct
tcagagctaagaaaaagtcttcagaatgatgctgaacacgccataaggatggttgatgag
atgaacgtgaatgcccagagggtaacccgtgatacctaccagagtctatataagaagatg
ttggctcaggagagccagagtatccctgagaaactcaagaaaatggtgttaggcagtcta
gtacgtattactcagaagtaccacatggcagtcacatggctgatggactcagtcattcat
ttcctgaagttcaatagagtccagttcccagggaatgctggaacatatactgtggacgaa
ctttacactatagccatgagggaaaccaagaagttactctctcagctgtttaatgggtta
ggacacctgttttcctatgttcaagaccaagtagagaaatcaagagtaatcaatgacata
acatttaaatgtcccttttccccaacaccttgtaaactaaaagatgtcctattgattttc
agggaggacttaaacattttatccaacttaggccaacaggatatcaattttacaacaata
ctaagtgactttcagagctttttggagagacttttagacatcatagaagaaaaaattgaa
tgcctaaagaacaatgaatctacttgtgtccctgatcatatcaacatgttcttcaaaaca
catatcccatttgcatttaaatccctgagagaaaacatatactctgtcttcagtgagttc
aatgactttgttcaatccatacttcaagaggggtcctataagctacagcaggtccatcag
tatatgaaggcctttcgtgaagagtattttgatccgagtgtggttggctggacagtaaaa
tattatgaaatagaagaaaagatggttgaccttatcaagacccttttggctcctctgagg
gatttctactctgaatacagtgtgacagctgctgattttgcttccaaaatgtcaactcag
gttgagcaatttgtgtccagggatatcagagagtatcttagcatgcttgctgacataaat
ggaaaggggagggaaaaggttgcagagctttctattgtggtaaaggaaagaataaaaagc
tggtccactgcggtggcagaaataacgtctgattacctccggcagctccattccaaactg
caggatttttcagaccagctctctggctactatgaaaaattcgttgctgagtccacaaga
ctgattgacctgtccattcaaaactaccacatgtttctcagatacatcgctgagttactg
aaaaagctgcaggtggccacagccaataatgtgagcccctacctaaggtttgctcaagga
gaactgattatcaccttctga

DBGET integrated database retrieval system