KEGG   Rattus norvegicus (rat): 54226Help
Entry
54226             CDS       T01003                                 

Gene name
App, Abeta
Definition
(RefSeq) amyloid beta precursor protein
  KO
K04520  amyloid beta A4 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04726  Serotonergic synapse
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    54226 (App)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54226 (App)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    54226 (App)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    54226 (App)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    54226 (App)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   54226 (App)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Others
   54226 (App)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Others
   54226 (App)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APP_E2 APP_N APP_amyloid APP_Cu_bd Beta-APP Kunitz_BPTI Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 54226
NCBI-ProteinID: NP_062161
RGD: 2139
Ensembl: ENSRNOG00000006997
UniProt: P08592
Structure
PDB: 

Position
11q11
AA seq 770 aa AA seqDB search
MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTK
TCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDSIDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEE
EAEDDEDVEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSVSSQSLLKTTSEPLPQD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccagcctggcactgctcctgctggccgcctggacggttcgggctctggaggtg
cccactgatggcaatgccggtctgctggcagaaccccagatcgccatgttctgtggtaaa
ctcaacatgcacatgaatgtgcagaatggaaaatgggagtcagacccatcagggaccaaa
acctgcattggcaccaaggagggaatcctgcagtactgccaagaggtctaccctgaactg
cagatcacaaacgtggtggaagccaaccagccagtgaccatccagaactggtgcaagcgg
ggccgcaagcagtgcaagacgcacacccacatcgtgattccttaccggtgcctagttggt
gagtttgtaagcgatgcccttctcgtgcccgacaagtgcaagtttctacaccaggagcgg
atggacgtttgtgagacccatcttcactggcatactgttgccaaagagacatgcagtgag
aagagcactaacttgcacgactatggcatgctgctgccctgtggcatcgacaagttccga
ggggtcgagttcgtgtgctgcccgttggcggaggagagcgacagcatcgattctgcggac
gcagaggaggacgactccgatgtctggtggggtggagcggacacagactatgctgatggc
ggtgaagacaaagtcgtagaagtagccgaagaggaggaagtggccgatgttgaggaagaa
gaagctgaggatgacgaggatgtggaggatggggatgaggtggaggaggaggccgaggag
ccctacgaagaggccacagagagaacaaccagcattgccaccactaccacaactaccact
gagtctgtggaggaggtagtccgagaggtgtgctctgaacaagctgagaccgggccatgc
cgtgcaatgatctcccgctggtactttgatgtcactgaaggaaagtgcgccccattcttt
tacggcggatgtggcggcaacaggaacaactttgacactgaagagtactgcatggcggtg
tgtggcagcgtgtcatcccaaagtttactcaagactaccagtgaacctcttccccaagat
ccggttaaacttcccacgacggcagccagcacccctgacgcagtcgacaagtacctggag
acccccggagatgagaacgagcacgcccatttccagaaagccaaagagaggttggaagcc
aagcaccgagagagaatgtcccaggtcatgagagaatgggaggaggcagaacgtcaagcc
aagaatttgcccaaagctgacaagaaggccgttatccagcatttccaggagaaagtggaa
tctctggaacaggaagcagccaacgagaggcagcagcttgtagagacacacatggccaga
gttgaagccatgctcaatgatcgccgtcgcctggccctcgagaattacatcaccgcactg
caggcggtgcctccaaggcctcatcatgtgttcaacatgctgaagaagtacgtccgtgca
gagcagaaggacagacagcacaccctaaagcattttgaacatgtgcgcatggtggacccc
aagaaagctgctcagatccggtcccaggttatgacacacctccgtgtgatctacgagcgc
atgaaccagtctctgtccctgctctacaacgtccctgccgtggctgaggagattcaagat
gaagttgacgagctgcttcagaaggagcagaactactccgacgacgtcttagccaacatg
atcagtgaacccagaatcagttacggcaacgatgctctcatgccttctttgactgaaacg
aagaccactgtggagctccttcccgtgaatggcgaattcagcctggatgatctccaaccg
tggcatccttttggggtggactctgtgccagccaatacagaaaatgaagttgagcctgtc
gacgcccgccccgctgctgaccgaggactgaccactcgaccagggtctgggttgacaaac
atcaagacagaagagatctcagaagtgaagatggatgcggagttcggacatgattcaggc
ttcgaagtccgccatcaaaaactggtgttctttgcagaagatgtgggttcaaacaaaggt
gccatcattggactcatggtgggtggcgttgtcatagcaacagtgattgtcatcaccttg
gtgatgctgaagaagaaacagtacacatccatccatcatggcgtggtggaggttgacgct
gctgtgaccccggaggagcgccacctctccaagatgcagcagaatggatatgagaatcca
acatacaagttctttgagcagatgcagaactaa

DBGET integrated database retrieval system