KEGG   Rattus norvegicus (rat): 54233Help
Entry
54233             CDS       T01003                                 

Gene name
Ca5a, Ca5, Car5a
Definition
(RefSeq) carbonic anhydrase 5A
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    54233 (Ca5a)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     54233 (Ca5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 54233
NCBI-ProteinID: NP_062166
RGD: 2243
Ensembl: ENSRNOG00000019098
UniProt: P43165
Position
19q12
AA seq 304 aa AA seqDB search
MLRAKMLGRGPYKPLAILRHMGPLCATRPQHWRFQHSYAEKHSNCARHPLWTGPVSSPGG
TQQSPINIQWTDSVYDPKLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEESGISGGPLG
NHYRLKQFHFHWGATDEWGSEHMVDGHAYPAELHLVHWNSMKYENYKKATTGENGLAVIG
VFLKLGAHHEALQRLVDILPEVRHKDTQVTMGPFDPSCLLPACRDYWTYPGSLTTPPLAE
SVTWIVHKMPIEVSPSQLSTFRTLLFSGRGEDEEVMVNNFRPLQPLRGRNVRSSFQVPRV
GTKS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagccaagatgctcgggagaggcccctacaagcccttagccatcctcaggcac
atgggacctctctgtgccacaaggccacagcactggcgcttccagcattcctacgcagag
aaacacagcaactgtgcccggcaccctctctggactggcccagtgtcctcaccgggaggc
acccagcagtctcccattaatatccagtggacggatagtgtctatgacccgaagctggca
ccgctcagggtctcctatgatgctgcgtcctgcagatacctctggaacactggttacttc
ttccaggtggagtttgacgattcctgtgaggagtcagggatcagtggtgggcctctggga
aaccactacaggctgaagcagtttcacttccactggggagcaacagatgaatggggctct
gagcacatggtggacggccatgcctacccggctgagctccatttggttcactggaattcc
atgaaatatgaaaattacaagaaagccaccacgggggagaatggactggcggtgattgga
gtgtttctgaagctcggggcccatcacgaggccctgcagaggctggtggacatcttgccg
gaagtaagacacaaggacacacaggtgaccatggggccctttgacccttcttgcctgctg
cctgcctgccgggattactggacctaccctggctccctcaccaccccaccactggctgag
tcagtcacctggattgtgcacaagatgcccattgaggtgtccccgagccagctgtccaca
ttccgtacactcttgttctccgggcgaggtgaggacgaggaggtgatggtgaacaacttc
cgcccgctccaaccactcaggggccgcaacgttcgctcctccttccaggtccccagggtg
ggaacaaagtcttga

DBGET integrated database retrieval system