KEGG   Rattus norvegicus (rat): 54237
Entry
54237             CDS       T01003                                 

Gene name
Cdk1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno04540  Gap junction
rno04914  Progesterone-mediated oocyte maturation
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    54237 (Cdk1)
   04114 Oocyte meiosis
    54237 (Cdk1)
   04115 p53 signaling pathway
    54237 (Cdk1)
   04218 Cellular senescence
    54237 (Cdk1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    54237 (Cdk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    54237 (Cdk1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    54237 (Cdk1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    54237 (Cdk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    54237 (Cdk1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    54237 (Cdk1)
   03036 Chromosome and associated proteins [BR:rno03036]
    54237 (Cdk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    54237 (Cdk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     54237 (Cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     54237 (Cdk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   54237 (Cdk1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    54237 (Cdk1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    54237 (Cdk1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   54237 (Cdk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase ABC1 APH Kinase-like Seadorna_VP7 Kdo Choline_kinase
Other DBs
NCBI-GeneID: 54237
NCBI-ProteinID: NP_062169
RGD: 2319
Ensembl: ENSRNOG00000000632
UniProt: P39951
Position
20
AA seq 297 aa
MEDYIKIEKIGEGTYGVVYKGRHRTTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaggactatatcaaaatagagaaaatcggagaagggacttatggtgtggtatataaa
ggtagacacaggactactggccagatcgtggccatgaagaaaatcagacttgaaagcgag
gaagaaggagtgcccagtacggcaatccgggaaatctctctgttaaaagaacttcgacat
ccaaatatagtcagcctgcaggatgtactcatgcaggactccaggctgtatctcatcttc
gagttcctgtccatggatctcaagaagtacctggactctatccctcctggccagttcatg
gattcttcgctcgttaagagttacttgtaccaaatcctccaggggattgtgttttgtcac
tcccgacgagttcttcacagagacttgaaacctcaaaatctattgattgatgacaaagga
acaatcaaactggcagatttcggccttgccagagcgtttggaataccgataagagtgtac
acacacgaggtagtgacgctgtggtaccggtcgccagaggtgttgctgggctcggctcgc
tactccaccccggttgacatctggagcatagggaccatatttgcagagctggcgaccaag
aagccgcttttccacggcgactcagagattgaccagctcttcaggatcttcagagctctg
ggcacccctaacaacgaagtgtggccagaagtagagtccctgcaggactacaagaacact
ttccccaagtggaagccggggagcctcgcgtcccacgtcaagaacctggatgaaaacggc
ttggacttgctctcgaaaatgctggtctatgatccagccaaacgaatctctggaaaaatg
gcccttaagcacccatactttgacgacttggacaatcagatcaagaagatgtaa

DBGET integrated database retrieval system