KEGG   Rattus norvegicus (rat): 54240
Entry
54240             CDS       T01003                                 

Gene name
Chrnd
Definition
(RefSeq) cholinergic receptor nicotinic delta subunit
  KO
K04816  nicotinic acetylcholine receptor delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    54240 (Chrnd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    54240 (Chrnd)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   54240 (Chrnd)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Wzy_C
Other DBs
NCBI-GeneID: 54240
NCBI-ProteinID: NP_062171
RGD: 2352
Ensembl: ENSRNOG00000019527
UniProt: P25110
Position
9q35
AA seq 517 aa
MAGPVPTLGLLAALVVCGSWGLNEEQRLIQHLFEEKGYNKELRPVARKEDIVDVALSLTL
SNLISLKEVEETLTTNVWIDHAWIDSRLQWNANEFGNITVLRLPSDMVWLPEIVLENNND
GSFQISYACNVLVSDSGHVTWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIR
LSLKQEEEDNRSYPIEWIIIDPEGFTENGEWEIVHRAAKVNVDPSVPMDSTNHQDVTFYL
IIRRKPLFYIINILVPCVLISFMINLVFYLPGDCGEKTSVAISVLLAQSVFLLLISKRLP
ATSMAIPLVGKFLLFGMVLVTMVVVICVIVLNIHFRTPSTHVLSEGVKKFFLETLPKLLH
MSRPEEEDPGPRALIRRTSSLGYISKAEEYFSLKSRSDLMFEKQSERHGLARRLTTARKP
PASSEQVQQELFNEMKPAVDGANFIVNHMRDQNSYNEEKDNWNQVARTVDRLCLFVVTPV
MVVGTAWIFLQGVYNQPPPQPFPGDPFSYDEQDRRFI
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcagggcctgtgcccacactggggctgctggctgcccttgttgtgtgtggcagctgg
ggcctgaatgaggaacaaaggctgatccagcacctgtttgaggaaaaaggctacaacaaa
gaacttcggccggtggctcgaaaggaggacatagtggatgtcgccttaagtctgaccctc
tccaacctcatctccctgaaagaagtggaggagaccctcaccaccaatgtgtggatagat
catgcatggatagacagccggctacaatggaatgccaacgagtttgggaacatcaccgtc
ctgcgcctgccctctgacatggtgtggctaccagaaattgtactggagaacaacaatgac
ggctcattccagatttcttacgcctgcaatgtgcttgtttctgactcgggccatgtgacc
tggctgccacccgccatcttccgctcctcctgccccatctcggtcacctacttccctttc
gattggcagaactgctccctcaaattcagttcactcaagtataccgccaaggagatcaga
cttagcctgaagcaggaggaggaagacaaccgcagttaccccattgagtggatcatcatt
gaccctgagggtttcacagagaacggtgagtgggaaatagttcaccgggcagccaaggtc
aacgtggaccccagtgtcccaatggacagcaccaaccaccaagacgtcaccttctacctc
atcatccgccgcaagccgctcttctacatcatcaacatcctggtaccctgtgtgctcatc
tccttcatgatcaacctggtcttctacctgccaggcgactgtggagagaagacctcggtg
gccatctcagtgctcctggcccaatctgtcttcctgttgcttatctccaagaggctgccg
gccacatccatggccattcctttggtaggcaagttcctgctttttggcatggtgctggtc
accatggttgtggtgatctgcgtcatcgtgctcaacatccacttccgaacacccagcacg
catgttctgtctgagggagtcaagaagttcttcctggagaccctgcccaaactcctgcac
atgtcccgcccagaagaggaagacccgggccccagggctctcatccggaggaccagctct
ctgggatacatctccaaggcagaggagtacttctcacttaagtcccgcagtgacctcatg
tttgagaagcaatcagagcggcatgggctggcccggcgcctcaccacagcccgcaagcca
ccagcaagctctgagcaggtccaacaggagcttttcaatgagatgaagccagccgtggat
ggggcgaacttcatcgtcaaccacatgagggaccagaacagttacaatgaggagaaggac
aactggaaccaggtggcccgcacagtggaccgtctctgcttgtttgtggtgacgcccgtc
atggtggtgggcacagcctggatcttcctgcagggtgtctacaaccagcccccaccccag
cctttccctggggaccccttctcctatgatgaacaggacaggcgcttcatttag

DBGET integrated database retrieval system